(data stored in SCRATCH zone)

EMBL: CR848038.PE42

CR848038.PE42        Location/Qualifiers
FT   CDS_pept        complement(52771..53847)
FT                   /transl_table=11
FT                   /locus_tag="CAB042"
FT                   /product="hypothetical ATP:guanido phosphotransferase"
FT                   /EC_number="2.7.3.-"
FT                   /note="Similar to Chlamydia pneumoniae hypothetical
FT                   ATP:guanido phosphotransferase cpn0701 or cp0045 or cpj0701
FT                   SWALL:Y701_CHLPN (SWALL:Q9Z7K4) (358 aa) fasta scores: E():
FT                   2.6e-98, 66.76% id in 358 aa, and to Chlamydia muridarum
FT                   hypothetical ATP:guanido phosphotransferase Tc0046
FT                   SWALL:Y046_CHLMU (SWALL:Q9PLP9) (356 aa) fasta scores: E():
FT                   3.5e-76, 54.39% id in 353 aa, and to Chlamydia trachomatis
FT                   hypothetical ATP:guanido phosphotransferase Ct675
FT                   SWALL:Y675_CHLTR (SWALL:O84682) (356 aa) fasta scores: E():
FT                   1.4e-73, 54.1% id in 353 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB042"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63500"
FT                   /db_xref="GOA:Q5L768"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L768"
FT                   /protein_id="CAH63500.1"
FT                   /translation="MILSNDLLLNFASKKDAPPTNKTWPITTFSLSRNLSIAKFLPCLS
FT                   REKKQEILEVIASHFNHIEGFDEFLVLPLKDAPAWQKEFLIEHFLFPYDLTGNPEGEAL
FT                   IVNRSGNILAAINFRDHLILHAIDFTSEPEKALDQLVRLDSYLNEKLAFAFSPDFGFLT
FT                   TNPRECGTGLKSQSFLHAPALVYSRELAEIIDEDTEVACSGILPGTPEYIGNIVVLSNK
FT                   CSLGLTEEQILSSLRIWSSKIAVAEASAKKKHAEQNPGELKNHILRALGLLTHSYHLDL
FT                   QETLDALSWIQLGISLGWIQGSDNSSIWNPVFWQARRGHLALTKQPEDNKSLQKEVISQ
FT                   LRADVLKRLAEGLSANGF"
     atgattcttt ccaatgactt acttcttaat tttgctagta agaaagacgc tcctcctaca        60
     aataaaacct ggcctataac gacgttctca ctatctagga acctttccat agcgaagttt       120
     cttccttgct tatctaggga gaaaaaacaa gaaattttag aggttatcgc ctcacatttt       180
     aaccatattg aaggttttga tgagtttcta gttttacccc tgaaagatgc acctgcctgg       240
     caaaaagagt ttctcattga gcatttttta tttccctatg atcttacagg taaccctgaa       300
     ggcgaagctc ttattgtcaa ccgctctgga aatattctcg ccgctataaa tttccgggat       360
     catctgattc tccatgctat agattttaca tcagaacccg aaaaagcctt agatcagctt       420
     gtgcggttag acagttatct gaatgaaaaa ttagcatttg ctttttcccc tgattttggt       480
     tttctaacta caaatcctcg agaatgcggc acaggattaa aaagtcagag ttttctacat       540
     gctccggcat tggtttactc tcgcgaattg gctgagatta ttgatgagga tacagaggtt       600
     gcgtgttctg gcattttacc aggaactccc gaatatattg ggaatattgt agttttatcg       660
     aataaatgtt ctttagggct taccgaagaa caaatcttat catcactcag aatatggtct       720
     tcgaaaattg ctgttgccga agcttccgcg aaaaagaagc atgctgagca aaatcctggg       780
     gagttaaaaa accatattct gcgtgctcta ggcttactta cacactccta tcatttagat       840
     ctccaagaaa cgttagatgc attaagttgg atccaattag ggattagctt aggatggatc       900
     caaggttccg ataacagttc catttggaat cctgtattct ggcaggcacg tcgtgggcac       960
     ttagctctta caaaacaacc tgaagataat aagagtttac aaaaagaagt tatctcacag      1020
     ttacgtgcag atgtgttaaa gagacttgcc gaaggcttat ctgctaatgg cttttaa         1077
//

If you have problems or comments...

PBIL Back to PBIL home page