(data stored in SCRATCH zone)

EMBL: CR848038.PE424

CR848038.PE424       Location/Qualifiers
FT   CDS_pept        complement(495195..496181)
FT                   /transl_table=11
FT                   /locus_tag="CAB429"
FT                   /product="putative exported protein"
FT                   /note="Similar to Chlamydia pneumoniae Omp cpj0342 or
FT                   cp0417 SWALL:Q9RB74 (EMBL:AE002203) (325 aa) fasta scores:
FT                   E(): 3.3e-100, 75.84% id in 327 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB429"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63882"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L649"
FT                   /protein_id="CAH63882.1"
FT                   /translation="MQMNKLLLILLFLISGTSILADTSIIQTLPSGIGGIQETSQQKES
FT                   VICVHAFLRSYRSLKPIGNVLEKENYDVFIWNYETRKFTIEKHADHLVKLIIKIAELKP
FT                   GVPINFVTHSIGGVIVRVALAKPDCPQEAKCGKAILMAPPNAGSTLARRYRSLAIVQFI
FT                   FGGKLGRQLLTYCPRKMLNVGKLPSTVDVLILSGNKRSKFLPFRLECENDGKVCTVETR
FT                   LDTPHKGYVINTNHTYIITNKKSIFLMREFLKHGSKTAAIEQVPEEIELQVKEDKQKSS
FT                   RLNTNKNKDIYIIHCFGSHPYNLYGFPKIWKPNSLQKSETNPETLEK"
     gtgcaaatga ataaattatt attaatttta ctatttttaa tatctggaac ctctatttta        60
     gcggatacct ctataattca aacacttcct tcgggaattg gtggaataca agaaacatcc       120
     caacaaaaag aatccgtaat ctgcgttcac gcatttttaa gatcttacag gtcactaaaa       180
     cctattggta atgtcttaga aaaagaaaat tacgacgtgt ttatctggaa ctatgaaact       240
     cgaaaattta caatagaaaa acatgccgat catcttgtta aactgattat aaagattgca       300
     gagctcaagc caggagtccc tattaacttt gtaacgcatt ctataggagg cgttattgtt       360
     cgcgtagccc tggcaaaacc agattgccct caagaagcca agtgtggaaa agctatactg       420
     atggcccctc caaatgccgg gtcgacatta gcaagacgct atagatcctt agccattgta       480
     caattcattt ttggaggtaa attaggaaga cagttactca cctactgtcc aagaaaaatg       540
     cttaatgtcg gtaagctccc ttcaactgta gacgttctta tactgagtgg aaataaacgc       600
     agtaagtttc tgcctttccg tttagaatgc gaaaatgacg gaaaagtgtg cactgtggag       660
     acccgcttag atactccaca taaaggttat gtaattaaca ccaaccacac ctatatcatc       720
     acaaataaga aatctatttt cctcatgaga gagtttctaa aacacggaag caaaactgca       780
     gctatagaac aagttccaga ggaaatagaa ctccaagtaa aggaagataa acaaaaaagc       840
     tctaggttga atacaaacaa aaacaaagat atttatatta tccattgttt tggttctcat       900
     ccttataacc tttatggatt tcctaaaatc tggaaaccta actcactgca aaaaagcgaa       960
     acaaatcctg aaacgttaga aaaataa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page