(data stored in SCRATCH zone)

EMBL: CR848038.PE431

CR848038.PE431       Location/Qualifiers
FT   CDS_pept        501657..501947
FT                   /transl_table=11
FT                   /locus_tag="CAB436"
FT                   /product="late transcription unit B protein"
FT                   /note="Similar to Chlamydia trachomatis CDS idenitfied in
FT                   the intracellular developmental cycle as a late
FT                   transcription unit B protein LtuB or ct080 SWALL:LTUB_CHLTR
FT                   (SWALL:Q46404) (97 aa) fasta scores: E(): 1.1e-10, 51.02%
FT                   id in 98 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB436"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63889"
FT                   /db_xref="InterPro:IPR020502"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L642"
FT                   /protein_id="CAH63889.1"
FT                   /translation="MSGTKKKRNRRDLSRVIQKKTEKLLNRPKKLKEKKSKFLISKDQE
FT                   QLRHRAEEYDTLVHSLLDKQFHDSNHVLIFNYQDGFVFTDINNFGRYSIKL"
     atgagtggga caaagaagaa aagaaaccga cgagatttgt ctcgcgtgat tcagaaaaag        60
     acagagaagc ttctgaatag acctaaaaaa ttaaaagaaa agaaatccaa gttccttatt       120
     tccaaagatc aagagcagtt gcgtcatcgt gcagaggagt atgatacttt agtgcattcc       180
     ttattagata agcaatttca tgattctaat catgttttaa tttttaacta tcaggatggt       240
     ttcgtattta ctgatattaa taattttgga aggtattcta taaaactata a                291
//

If you have problems or comments...

PBIL Back to PBIL home page