(data stored in SCRATCH zone)

EMBL: CR848038.PE434

CR848038.PE434       Location/Qualifiers
FT   CDS_pept        complement(504508..505566)
FT                   /transl_table=11
FT                   /locus_tag="CAB439"
FT                   /product="putative exported protein"
FT                   /note="Similar to Chlamydophila caviae hypothetical protein
FT                   cca00453 SWALL:O34024 (EMBL:U88070) (351 aa) fasta scores:
FT                   E(): 8.1e-103, 72.72% id in 352 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB439"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63892"
FT                   /db_xref="GOA:Q5L639"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L639"
FT                   /protein_id="CAH63892.1"
FT                   /translation="MQKKTKSKLKIALTLGTILLFGFLTKSQPPDTFQTFLALREPVIY
FT                   SKQCGDNSIKVLCDAIDSAKESLFLRIYRLTAPEIVKSLANQAKSQRHVVIHYEKMTKV
FT                   EEFPQNANVSLVNHPCKERKLMHKKSLAIDDKYAWLGSANYTRVSFLDDSNLIIGLKSK
FT                   ELCQYIKNESSGECVMQGQKVQYFSLPGDGGKALSAVLHTLRTAKKTIRLAMFALTYPP
FT                   IFEELNAAQKRGVDVKILIDKDFEKLSIARLQALIDPKLKLYTKTTRHRLHHKFAIIDQ
FT                   STLITGSVNWSISGFCSNTEDMLILDNLTKKQINKLNRIWKDLETQSTLSYPPMRKEKE
FT                   VIIQLPKEQRAA"
     atgcaaaaga aaacaaaatc aaaattaaaa atcgctttaa ctttaggaac aattttatta        60
     ttcggattcc tgacaaaatc tcaacctccg gatactttcc aaacgttcct ggccttacgt       120
     gaacctgtca tctattcaaa acagtgtggg gataactcta ttaaagtgct atgcgatgcg       180
     attgattccg caaaggaaag tttgtttctt cgtatttacc gtctgactgc tcccgaaatt       240
     gtgaaaagtc ttgctaatca agctaaatct caacgccatg tggtcattca ctatgaaaaa       300
     atgaccaagg ttgaagaatt ccctcaaaac gctaatgtct ccttagttaa tcacccgtgc       360
     aaagaacgca aactgatgca taaaaaatct ctagccatag atgataaata cgcctggtta       420
     ggttcagcaa actatacccg ggtatccttt cttgacgata gtaacctgat tattggatta       480
     aagagcaaag agctttgtca gtatattaaa aatgagtctt caggagagtg tgttatgcaa       540
     ggacagaaag tacaatactt ttccctacct ggagatggag ggaaagcttt atcagcggta       600
     ttacacacgc taagaactgc taaaaaaacc atacgtttag ccatgtttgc cttaacctat       660
     cctcctattt ttgaggagct gaatgccgca caaaaacgtg gtgttgacgt gaagatttta       720
     attgataaag atttcgagaa actctccata gcgcgactac aagcattaat agaccctaaa       780
     ttaaaattat acacaaaaac aacacggcat cgcctacacc ataagtttgc tattatagac       840
     caaagtactc taatcacagg atcggtaaac tggtcaatat ctgggttttg cagcaataca       900
     gaagatatgc tgattcttga taatcttaca aagaaacaaa taaataaact gaatagaatc       960
     tggaaagact tagaaacaca aagtacctta tcctatccgc caatgagaaa agaaaaggaa      1020
     gtgataattc aactacctaa agaacagcgt gcagcttaa                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page