(data stored in SCRATCH zone)

EMBL: CR848038.PE439

CR848038.PE439       Location/Qualifiers
FT   CDS_pept        complement(509971..511167)
FT                   /transl_table=11
FT                   /locus_tag="CAB444"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa (Pseudomonas outer
FT                   membrane protein) PopN or pa1698 SWALL:O30531
FT                   (EMBL:AF010150) (288 aa) fasta scores: E(): 0.26, 23.82% id
FT                   in 256 aa, and to Chlamydophila caviae CopN protein copn or
FT                   cca00458 SWALL:O34020 (EMBL:U88070) (397 aa) fasta scores:
FT                   E(): 2.3e-120, 86.68% id in 398 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB444"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63897"
FT                   /db_xref="GOA:Q5L634"
FT                   /db_xref="InterPro:IPR010812"
FT                   /db_xref="InterPro:IPR013401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L634"
FT                   /protein_id="CAH63897.1"
FT                   /translation="MAASGGAGGLGGAQAVDVAQVQAAAAKADAQEVVASQEQSDISMI
FT                   RDSQDLTNPQAATRTKKKEEKFQTLESRRKGAAQTEKKSESTGDKSDADLADKYTENNA
FT                   EISGQDLRSIRDALHDGSSEEDILDLVKSKFSDLALQGIALDYLVQTTPASKGALKDSL
FT                   IKAQQTHMQQNRQAVVGGKNILFASQEYANILQTSAPGLRALYLQVTSDFHTCEQLLQM
FT                   LQTRYNYEEMGTVSSFILKGMSADLKSEGSSVSPVKLKVMMSETRNLQAVITGYTFFQD
FT                   KFPNVMASLKADGASIPEDLKFDKVADTFFKLINDKFATASKMERGVRDLVGNDTEAIT
FT                   GILNLFFTALRGTSPRLFSSAEKRQELGTMMANALDSVNTHNEDYPKSTDFPKPYPWS"
     atggcagcat ctggaggagc cggaggccta ggtggtgcac aagctgttga tgttgcgcaa        60
     gtacaagctg cagcagcaaa agccgatgcc caagaagttg tagctagtca agagcaatct       120
     gacattagca tgattcggga ttctcaggat ttgacgaatc ctcaggcagc aacgcgcacg       180
     aagaaaaaag aagagaaatt tcaaacctta gaatccagaa gaaaaggtgc cgcgcaaaca       240
     gaaaaaaaat ctgaaagtac tggcgataaa tctgatgccg atcttgctga taaatatacc       300
     gaaaacaatg cagaaatttc aggtcaagat ttacgcagta tccgcgatgc tttacatgat       360
     ggttcttctg aagaagatat cttagatctt gtaaaatcta aattttctga tcttgccctg       420
     caaggtattg ccttagatta cctagtccaa accacaccag catccaaagg tgctttaaaa       480
     gactctttaa tcaaagcaca acaaactcac atgcaacaga atcgacaagc tgttgttggt       540
     ggtaaaaata ttctatttgc ctcgcaagag tatgccaata ttttacaaac atctgctcca       600
     ggcttacgtg ctctctatct tcaggtgacc tccgattttc atacatgtga gcaattactt       660
     cagatgttgc agacacgcta caactatgaa gaaatgggaa ctgtatcttc ttttattctt       720
     aaagggatgt ctgccgattt aaaatcagaa gggtcttctg tgtcacccgt aaaactaaag       780
     gtgatgatgt cagaaactcg caatcttcaa gctgtgatta ccggttatac ttttttccag       840
     gataaattcc ctaatgttat ggcatcttta aaagcggatg gagcgtctat ccctgaagat       900
     ctcaaattcg ataaagttgc tgataccttc tttaagttaa tcaacgataa attcgcgaca       960
     gcttcaaaaa tggagcgagg agttcgtgat cttgttggta atgatactga agctattact      1020
     gggatactga accttttctt tactgcccta agaggaactt caccgagatt attttcttca      1080
     gcagaaaagc gtcaagaatt aggtacgatg atggcgaatg ccttggattc tgtgaatacc      1140
     cataatgaag attacccaaa atctacagac ttcccgaaac cttacccttg gtcttaa         1197
//

If you have problems or comments...

PBIL Back to PBIL home page