(data stored in SCRATCH zone)

EMBL: CR848038.PE455

CR848038.PE455       Location/Qualifiers
FT   CDS_pept        complement(530424..530780)
FT                   /transl_table=11
FT                   /locus_tag="CAB460"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Chlamydophila caviae hypothetical protein
FT                   cca00474 SWALL:Q823E5 (EMBL:AE016995) (131 aa) fasta
FT                   scores: E(): 2.4e-19, 52.89% id in 121 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB460"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63913"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L618"
FT                   /protein_id="CAH63913.1"
FT                   /translation="MTSAHEFGAFSGRANRNVFTLNDFKGSDSTRYQKPRISQDTVSVA
FT                   RPYTDRHPKGLTIQHTALWVTLGVVSMCSTSLLFASGYYATPTILVALILQIALTIVSI
FT                   ACLIIHYALRKKLV"
     atgacctcag cacatgaatt tggggcgttc tccggacgag caaatagaaa tgtctttact        60
     ctcaacgatt ttaaaggctc cgattctaca aggtatcaaa aacccagaat ctctcaagac       120
     acagtcagcg tagctcgccc ttatacggat aggcatccta aaggcctcac gattcagcat       180
     acagctcttt gggtaacttt aggcgtcgtc tctatgtgtt cgactagctt gttattcgca       240
     agtggctatt acgcaacacc tacaatttta gtagcactca ttttacagat tgctttgaca       300
     atagtgtcta tagcctgttt gattatccac tatgctctga ggaaaaagtt agtgtag          357
//

If you have problems or comments...

PBIL Back to PBIL home page