(data stored in SCRATCH zone)

EMBL: CR848038.PE63

CR848038.PE63        Location/Qualifiers
FT   CDS_pept        77681..79186
FT                   /transl_table=11
FT                   /locus_tag="CAB063"
FT                   /product="conserved hypothetical (serine rich) protein"
FT                   /note="Similar to Chlamydophila caviae hypothetical protein
FT                   cca00062 SWALL:Q824S7 (EMBL:AE016994) (463 aa) fasta
FT                   scores: E(): 2.8e-44, 57.2% id in 500 aa and weakly to
FT                   Chlamydia pneumoniae hypothetical protein cpn0677 or
FT                   cpj0677 or cp0070 SWALL:Q9Z7M7 (EMBL:AE001650) (382 aa)
FT                   fasta scores: E(): 5.6e-07, 26.73% id in 318 aa. Only
FT                   significant full-length database matches are to
FT                   Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB063"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63521"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L747"
FT                   /protein_id="CAH63521.1"
FT                   /translation="MGINPSGRGSNNNDLWISGAHHQHEDVQDAGTGPSGVVGSHNIST
FT                   KNNTHESSSFLSRIASAVRSFFAGIFGDSSSRANSRASTPTPSPTSSRRFSEDSFGSCM
FT                   DVSGEEVDTRSVSSFSSVESSSEKSFSSLDSARSTEGAARGLQKKGYTPGIKVDIPKVP
FT                   DLASGPKRPNTPPPPPPTSPSVKTSPRGVSPSSSLTKSNTSSVASGSSATRPLKRKAPQ
FT                   PPSEGPTQPKLQRRGSTSSMSSIDSNDSTASRTSQEISSGIADKLKAELEAHHKTKQEQ
FT                   LAKLSDQIKERWTNHEAQEPIAYKLACLQTVTSRLGQARLEAQKEISVLRPGTSEYPLN
FT                   TAISLSRSIWDLGEKEQRQDGESVLLPVLVRMGLEGPKLGPDEDFVNYVDQIISEYGEP
FT                   EETYNWQGTLQSLARDLNSLRETNPNGMKKFWSSFAGKGEITMRMIANRFASANVGKYD
FT                   PNSVRVERRWNTGALDLMNFLSSEAYVKTASILAYDALSVSED"
     atgggaatta atccaagcgg tcgcggcagt aataataatg atctatggat ttccggagct        60
     caccatcagc acgaggacgt acaagatgcg ggtacaggtc catccggagt agtagggtcc       120
     cataacattt ctaccaaaaa taatacccat gaaagctcga gctttttatc aagaatcgcg       180
     tctgctgtac ggagtttctt cgctggtata tttggtgatt cttcctcaag agccaattct       240
     cgcgcctcta ctcctacacc atccccaacg agtagtcgcc ggttttctga ggattctttc       300
     ggctcatgta tggatgtcag tggcgaggaa gtggatacac ggagtgtctc atcttttagc       360
     agtgtggagt cgagtagtga aaagagcttt agttctttgg atagcgcaag atcgacagag       420
     ggtgcggcta gaggattaca aaagaaaggt tatactccag gaattaaagt cgatattccc       480
     aaggtgccag atctcgcttc agggccaaag cgtcctaata cgccaccgcc accaccacca       540
     acttctccat ctgtaaaaac atcgccgcga ggtgtgagtc cttcttcctc actcacgaaa       600
     tccaacacat cttcagttgc ttcaggaagt agtgctacac gacctctcaa acgtaaagct       660
     cctcaacctc catcagaagg accaacacaa ccaaaattac aacgtcgggg cagtacgtct       720
     tctatgtcta gcatagactc taatgactca accgcgagca ggacctctca agaaatttcc       780
     tctggaatag cagataaatt aaaagcggaa ctagaagcgc accacaagac aaaacaagaa       840
     caattagcaa agttgtccga ccaaattaaa gaacgctgga caaatcacga agcacaggag       900
     ccaatagcgt acaaacttgc ctgtttacag acagtaacat ctaggttggg ccaagcacgc       960
     ctagaggcac aaaaagaaat aagtgtcttg cgacccggaa ctagtgaata ccccttaaat      1020
     actgctattt cgttatctcg atctatatgg gacctgggag agaaagaaca aagacaagat      1080
     ggagaatctg tactccttcc ggtattggta cgtatgggtt tagaagggcc gaagttaggt      1140
     cctgacgagg attttgttaa ttatgttgat cagattataa gtgagtacgg agagccagag      1200
     gaaacgtata actggcaagg cactttgcaa tctctagctc gtgatttaaa ttctctaaga      1260
     gagactaacc ctaacggtat gaaaaagttt tggtcttcgt ttgccggtaa gggagaaatc      1320
     actatgagaa tgatagcgaa tagatttgcc tctgcgaatg ttgggaaata cgatcctaat      1380
     tcagttcgag tagagcgccg ttggaataca ggagctctag atcttatgaa ttttttaagc      1440
     tcagaagctt atgtaaaaac agcttcgatc ttagcttatg acgctttgag tgtgtcagag      1500
     gattaa                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page