(data stored in SCRATCH zone)

EMBL: CR848038.PE72

CR848038.PE72        Location/Qualifiers
FT   CDS_pept        complement(86227..87183)
FT                   /transl_table=11
FT                   /locus_tag="CAB073"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Chlamydia pneumoniae ct547 hypothetical
FT                   protein cpn0668 or cpj0668 SWALL:Q9Z7N6 (EMBL:AE001649)
FT                   (318 aa) fasta scores: E(): 2.4e-85, 69.81% id in 318 aa.
FT                   Only significant database matches are to predicted
FT                   Chlamydiaceae proteins."
FT                   /db_xref="EnsemblGenomes-Gn:CAB073"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63530"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L740"
FT                   /protein_id="CAH63530.1"
FT                   /translation="MKSVLQFVVFLLLLSSGCYARPISFEPFSGKLSPQKFTPKYSTQE
FT                   YLSEGKRYLEQQRYRKALLCFGMITHHFPQDPLYSEALYLTGVCYFKNDQPDLAEKAFS
FT                   AYLQLPDANYSEELFLMKYSIAKSFAQGKRKRIFLLEGFPKLANADADALRIYDEILTA
FT                   FPNKDLGAQALYLKGDLLVTKKDFPEAIKTFKKLTLQFSAHPLSPKSFVRLSEIYLMQA
FT                   QKEPHNLQYLNLAKINEEAIAKQHPNHPLNSVVSANVRSMCERYALGLYSTGRFYEKKK
FT                   KPHAASIYYTTAIENYPESSLVAKCHKRLNRITKHSS"
     atgaaatctg ttttacagtt tgttgttttt ttactacttt tatcttctgg ctgctatgcc        60
     agaccgattt cttttgagcc tttttctggc aaattatctc ctcaaaagtt tacacctaag       120
     tactctacgc aagaatatct ttccgaagga aagcgctatt tagaacagca acgttatcgc       180
     aaagctcttc tttgctttgg catgattaca caccacttcc cccaagatcc gttatattct       240
     gaagctttat acttaacggg agtttgttac tttaaaaatg atcaaccaga cttagctgaa       300
     aaagcgtttt ccgcatattt acaacttcct gacgctaatt actctgaaga attattttta       360
     atgaaatatt ctatagccaa gagcttcgct caaggaaaac gtaagcgcat attcctttta       420
     gaagggtttc ctaaacttgc gaatgctgac gcagatgctt tacgtattta tgacgagatc       480
     ctcacggctt ttcctaataa agatttagga gctcaggctt tgtatcttaa aggggacctt       540
     cttgttacta aaaaggattt tcccgaagcg attaagacat ttaagaagct aacgttacaa       600
     ttctctgctc atcctctatc tccaaaatct tttgtgcgtc tttcagaaat ttatcttatg       660
     caggcacaaa aagaacccca taacttgcaa tatttaaacc ttgcaaagat taatgaagag       720
     gctatagcca agcagcaccc gaatcatcct ttaaatagcg ttgtttctgc gaatgtacgc       780
     tctatgtgtg agcgttatgc gttaggacta tactctacag gaagatttta cgagaaaaag       840
     aagaagcctc atgcagcgag tatctattat actactgcca tagaaaacta tcctgagtca       900
     tctttagtag ctaagtgtca taagcgactc aataggataa caaagcattc ttcttag          957
//

If you have problems or comments...

PBIL Back to PBIL home page