(data stored in SCRATCH zone)

EMBL: CR848038.PE75

CR848038.PE75        Location/Qualifiers
FT   CDS_pept        complement(91970..93337)
FT                   /transl_table=11
FT                   /locus_tag="CAB076"
FT                   /product="putative hexose phosphate transport protein"
FT                   /note="Similar to Chlamydia trachomatis probable hexose
FT                   phosphate transport protein ct544 SWALL:UHPT_CHLTR
FT                   (SWALL:O84548) (456 aa) fasta scores: E(): 1.8e-162, 83.85%
FT                   id in 452 aa, and to Bacillus subtilis glycerol-3-phosphate
FT                   transporter GlpT SWALL:GLPT_BACSU (SWALL:P37948) (444 aa)
FT                   fasta scores: E(): 3.9e-60, 41.11% id in 450 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB076"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63533"
FT                   /db_xref="GOA:Q5L737"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L737"
FT                   /protein_id="CAH63533.1"
FT                   /translation="MNIWTKFFQPPKHIKELDDPELVKKQYKYWRIRIFYSMFIGYVFY
FT                   YFTRKSFTFAMPTLMTDLGFDKAQLGIIGSTLYISYGVSKFVSGVISDQSNPRYFMALG
FT                   LIVTGFTNIFFGMSSSILLFALWWGLNGWFQGWGWPPCARLLTHWYSKSERGTWWSVWS
FT                   TSHNIGGALIPILTGFAIDCCGWRGAMFVPGILCILMGLVLINRLRDTPQSLGLPSIEK
FT                   FRKKQESQKHEETTVDILEEEAEKELSTREILFTYVLKNKWIWLLSFASFFIYVVRMAV
FT                   NDWSALFLIETKRYVAVKANFCVSLFEIGGLFGMLIAGWLSDKISKGKRGPMNVVFSLG
FT                   LLFSILGMWYSRNQDMWWLDGSLLFVIGFFLFGPQMMIGLAAAELSHKKAAGTASGFAG
FT                   WFAYFGAAFAGYPLGKIAQDWGWRGFFIALLGCALIALVLFLPTWNASERSLQTRK"
     atgaatattt ggaccaaatt ctttcagcct cccaagcaca ttaaagaact tgatgatcca        60
     gaattagtca aaaaacaata caagtattgg agaatccgca tcttctatag catgtttata       120
     gggtatgtct tctattattt cacaaggaag agttttacct ttgccatgcc cacactaatg       180
     acagatcttg gctttgataa agcgcaactg gggatcatcg gaagtacttt atacatcagt       240
     tacggtgtga gcaaatttgt tagtggtgtg atatctgacc agtccaatcc tcgttatttt       300
     atggcgctgg gtttaattgt tacaggattc actaatatct tcttcggaat gtcttcctcg       360
     atcttgttat ttgcattatg gtgggggctt aacggttggt ttcaaggctg gggctggcct       420
     ccatgtgccc gtttactcac tcactggtat tcgaaatctg aaagaggaac atggtggagt       480
     gtgtggagca cttcgcacaa tattggtggg gcattaattc ctattctcac aggatttgct       540
     attgattgtt gtggttggcg cggggcgatg tttgtccccg gtatactctg tattctcatg       600
     ggattagttt taattaatcg ccttcgtgat acgccacaat ccctaggtct tccttccatt       660
     gaaaaattcc gaaaaaaaca ggaatctcaa aaacacgaag aaaccactgt agatatttta       720
     gaagaagaag cagaaaaaga gctttctact agagaaatcc tctttactta tgtgttgaaa       780
     aacaaatgga tctggttatt gtcctttgct tcatttttca tttatgttgt ccgtatggcc       840
     gtcaatgatt ggagcgcttt attcttgatt gaaacaaagc gttacgtagc tgttaaagcc       900
     aatttctgtg tttctctatt tgagattggc ggactttttg gcatgttaat tgctggatgg       960
     ttatctgata aaatttccaa aggcaaacgc ggtcctatga atgttgtatt ttctttagga      1020
     ttgctattct ccattttagg catgtggtac agccgtaatc aagatatgtg gtggttagat      1080
     ggctcccttc tttttgttat tggctttttc ttgtttggtc ctcaaatgat gatagggtta      1140
     gcagctgctg aactatcaca taaaaaagct gcaggtacgg ctagcggctt tgcaggatgg      1200
     tttgcgtatt ttggagcagc gtttgcaggt tatccgttag gaaaaatagc tcaagattgg      1260
     ggctggagag gtttctttat tgcccttctg ggttgcgctt taatagcttt ggttttgttc      1320
     cttcctacat ggaatgcctc agagagaagt ttacaaacta gaaaataa                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page