(data stored in SCRATCH zone)

EMBL: CR848038.PGK

CR848038.PGK         Location/Qualifiers
FT   CDS_pept        76004..77215
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="CAB062"
FT                   /product="putative phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="Similar to Chlamydia pneumoniae phosphoglycerate
FT                   kinase Pgk or cpn0679 or cp0068 SWALL:PGK_CHLPN
FT                   (SWALL:Q9Z7M5) (402 aa) fasta scores: E(): 2.1e-128, 81.09%
FT                   id in 402 aa and Bacillus subtilis phosphoglycerate kinase
FT                   PgK SWALL:PGK_BACSU (SWALL:P40924) (394 aa) fasta scores:
FT                   E(): 2.4e-65, 46.61% id in 399 aa."
FT                   /db_xref="EnsemblGenomes-Gn:CAB062"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63520"
FT                   /db_xref="GOA:Q5L748"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L748"
FT                   /protein_id="CAH63520.1"
FT                   /translation="MDRLTVRELSPEEKKVLVRVDFNVPIKDGKILDDIRIRSAMPTIH
FT                   YLLQKRAAVILMSHLGRPQGKGFEEKYSLQPVVEVLEGYLGHHVPLAPDCVGEVARQAV
FT                   AQISPGRVLLLENLRFHPGEEHPEEHPAFAAELSSYGDFYVNDAFGTSHRKHASVYTVP
FT                   QAFPGRSAAGLLMEKELEFLGQHLLISPKRPFTAILGGSKVSSKIGVIEALLSQVDNLL
FT                   LAGGMGFTFLKALGKSVGNSLVEESGIELARRVLHIAQQRNVRIVLPIDVKVAKACTPA
FT                   VSWTEVSIDQGIPQDLEGLDIGTKTVQEFCKIIDASSTIFWNGPVGVYEVPPFDQGSMA
FT                   IANCLARHPSAITVVGGGDAAAVVALAGCTAQVSHVSTGGGASLEFLEKGFLPGTEVLS
FT                   PSQE"
     atggatagat tgacagtcag ggaactctcc ccagaagaaa aaaaggtttt agtccgtgta        60
     gattttaatg ttcctataaa agatgggaag attcttgatg atatccgcat ccgtagtgcg       120
     atgccgacaa ttcattatct attacaaaag cgcgctgctg taattttaat gagtcatctg       180
     ggtcgccctc aaggaaaggg tttcgaagaa aaatattctc tccagcctgt tgtggaagtt       240
     ttagagggtt acctaggtca tcacgtgcct ttagcccccg attgcgtagg agaagttgct       300
     cgtcaggcag tagcacaaat ttctccagga cgcgtgttgt tattagaaaa tcttcgtttt       360
     catccaggag aagaacatcc tgaagaacat cctgcttttg ctgcagaact ttcctcctac       420
     ggagattttt atgtgaatga tgcttttgga acttcacaca gaaaacatgc ctccgtgtac       480
     acggttcctc aagcttttcc agggcgatct gcggcaggtc ttcttatgga aaaagaactc       540
     gagtttttag gacagcacct gttaatttct cctaagcgtc cctttactgc gattcttggc       600
     ggttctaaag tatcttcaaa aatcggcgtt atcgaagcct tactctctca agtggataac       660
     ctacttttag caggcggcat gggctttact tttttaaaag cattaggaaa atccgtaggg       720
     aattccttag ttgaagaatc tggcatagaa ctcgcacgtc gggttttaca cattgcacaa       780
     cagcgtaatg tacgtatcgt tcttcctata gatgtgaagg ttgccaaagc ctgtactccc       840
     gcagtgtctt ggacggaagt ctctatagat caagggatcc ctcaagatct cgaaggccta       900
     gatataggaa caaaaactgt tcaagaattt tgtaaaatca tcgatgcctc atccaccata       960
     ttttggaatg gccctgttgg tgtttatgaa gtgcctcctt ttgatcaggg gtccatggct      1020
     atcgctaatt gtttagcacg acatccttct gccattacag ttgtgggagg tggagatgct      1080
     gctgctgttg ttgctttggc cggatgcaca gcacaagtct cacacgtgtc tacaggtggt      1140
     ggtgcgtctt tagaattcct agagaaaggt tttttaccag gaaccgaagt tctgtctcca      1200
     tcacaagagt aa                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page