(data stored in SCRATCH zone)

EMBL: CR848038.PMP14G

CR848038.PMP14G      Location/Qualifiers
FT   CDS_pept        complement(324168..326948)
FT                   /transl_table=11
FT                   /gene="pmp14G"
FT                   /gene_synonym="pomp98A"
FT                   /locus_tag="CAB282"
FT                   /product="polymorphic outer membrane protein"
FT                   /note="Previously sequenced as: Chlamydophila abortus
FT                   putative outer membrane protein SWALL:P71135 (EMBL:U72499)
FT                   (926 aa) fasta scores: E(): 0, 99.89% id in 926 aa. Also
FT                   highly similar to Chlamydia pneumoniae probable outer
FT                   membrane protein Pmp10 precursor or omp5 or cp0303
FT                   SWALL:PM10_CHLPN (SWALL:Q9RB65) (928 aa) fasta scores: E():
FT                   9.4e-144, 46.84% id in 952 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB282"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63732"
FT                   /db_xref="GOA:Q5L6J3"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6J3"
FT                   /protein_id="CAH63732.1"
FT                   /translation="MRPSLYKILISSTLTIPISFHFSQLHAEVALTQESILDANGAFSP
FT                   QSTSTAGGTIYNVESDISIVDVGQTAALASSAFVQTADNLTFKGNNHSLSITNANAGAN
FT                   PAGINVNTADKILTLTDFSKLSFKECPSSLVNTGKGAMKSGGALNLANNASILFDQNYS
FT                   AENGGAISCKAFSLTGSSKEISFTTNSTAKKGGAIAATGIAHLSDNQGTIRFSGNTAVN
FT                   SGGAVYSEASMTIAGNNHVAFSNNAVSGSSDGCGGAIHCSKTGSAPTLTIRDNKVLIFE
FT                   ENTSSAKGGAIYTDKLILTSGGPTAFINNKVTHATPKGGAIGIAANGECSLTAEHGDIT
FT                   FDNNLMATQDNATIKRNAINIEGNGKFVNLRAASGKTISFYDPITVEGNAADLLTLNKA
FT                   EGDKTYNGRIIFSGEKLTEEQAAVADNLKTTFTQPITLAAGELVLRSGVEVEAKTVVQT
FT                   AGSLILMDAGTKLSAKTEDATLTNLAINPNTLDGKKFAVVDAVAAGKNVTLSGAIGVID
FT                   PTGKFYENHKLNDTLALGGIQLSGKGSVTTTNVPSHVVGVAETHYGYQGNWSVSWVKDN
FT                   NSDPKTQTAIFTWNKTGYVPNPERRAPLVLNSLWGSFIDLRSIQDVLERSVDSILETRR
FT                   GLWVSGIGNFFHKDRNAENRKFRHISSGYVLGATTNTSREDSLSVAFCQLFAKDKDYLV
FT                   SKNAANVYAGSVYYQHVSKFDDLTRLFNGPNTCCSGFSKEIPIFLDAQITYCHTANNMT
FT                   TSYTDYPEVKGSWGNDTLGLTLSTSVPIPVFSSSIFDSYAPFAKLQVVYAHQDDFKEPT
FT                   TEGRVFESSDLLNVSVPIGIKFEKLSYGERSAYDLTLMYIPDVYRHNPSCMTGLAINDV
FT                   SWLTTATNLARQAFIVRAGNHIALTSGVEMFSQFGFELRSSSRNYNVDLGAKVAF"
     atgaggcctt ctttatataa gattttaata tcgtcgacgc tgacgatacc aatatctttt        60
     cacttctcgc aattgcatgc agaagtggct ttaactcaag aatctattct cgatgcaaat       120
     ggagcattca gtccgcaatc tacaagcact gcgggaggaa cgatttacaa cgtcgagagt       180
     gatatttcta ttgtagatgt aggacagaca gcggctcttg cttcctcagc ttttgttcag       240
     actgcagaca acctaacttt caaagggaac aaccatagct tatccataac gaacgcgaat       300
     gccggagcta atcctgcggg aattaacgtt aacactgccg ataagattct tacgctgaca       360
     gatttttcta agttgagctt taaggaatgc ccatcttctc tagtgaatac tggaaaaggg       420
     gctatgaaat ccggaggagc attaaactta gcgaataatg ccagtattct gtttgatcag       480
     aactattccg ctgagaatgg tggagccatc tcttgcaaag ctttttctct aaccggctcg       540
     agcaaagaaa tcagcttcac cactaactct actgcgaaaa aaggtggagc gattgctgct       600
     acgggaatag ctcatctttc ggacaaccaa ggcacaatca gattttctgg gaacactgct       660
     gtgaattctg ggggagcagt atattcagaa gcttctatga cgattgcagg taacaaccac       720
     gttgctttta gcaacaatgc tgtttccggt tcatctgatg gttgcggtgg agctatccat       780
     tgtagcaaaa caggttcagc accgaccctt actataagag ataacaaagt cttgattttt       840
     gaggaaaata cttcttcagc aaaaggtgga gcgatttaca ccgataaact catattgact       900
     tctggtgggc ctacggcatt tatcaataac aaagttaccc atgctacacc taagggtgga       960
     gctattggta ttgctgccaa tggagaatgt agcttaaccg ctgaacatgg ggatattact      1020
     tttgataata acctgatggc cacacaagac aatgctacaa taaaaagaaa tgccattaac      1080
     attgaaggca atggtaaatt cgtcaactta cgtgcagcgt ctggaaagac gatttctttc      1140
     tatgatccta tcacagttga aggtaatgct gctgatcttc tcactttgaa taaagctgag      1200
     ggtgataaaa cgtataatgg aagaattatt ttttcaggag aaaagctcac tgaagaacaa      1260
     gctgctgttg cggataacct aaagacaaca tttacacagc ctatcacttt agctgctggt      1320
     gaacttgtgt tacgcagcgg tgtggaagta gaagcaaaaa cagtcgtgca aacagcagga      1380
     tctttgattc tgatggatgc aggcacaaag ttatccgcaa aaacagaaga tgctacactg      1440
     acgaatctgg ctattaatcc gaatacctta gatgggaaaa aattcgccgt agtcgatgcc      1500
     gttgctgctg ggaagaatgt gactttatca ggtgctattg gcgttattga tcctacaggg      1560
     aagttttatg aaaaccataa gctaaatgat acgttagctt taggaggaat tcaactttct      1620
     gggaaaggtt cggtgacaac aaccaacgtg cctagtcatg ttgttggtgt tgctgaaacc      1680
     cactatggtt atcaaggaaa ctggtctgtc agttgggtca aagataataa ctctgatcct      1740
     aaaacacaaa cagcaatctt tacctggaat aaaacaggat atgttccaaa tcctgaacgt      1800
     cgtgctccgc tagtactcaa tagcctttgg ggatccttta tagatttacg ttctattcaa      1860
     gatgtcttgg aacgtagtgt tgatagtatt cttgagacac gtcgtggttt gtgggtctct      1920
     ggaattggga acttcttcca taaagatcgg aatgctgaaa atcgcaaatt ccgtcatatc      1980
     agttcgggat atgtgttagg agccacaaca aatacctcga gagaggattc tcttagtgtg      2040
     gctttctgtc agttatttgc aaaagataaa gactaccttg taagcaagaa cgccgcaaac      2100
     gtctatgcgg gttctgtata ttatcagcat gtgagcaagt ttgatgatct cacgcggtta      2160
     tttaatgggc ctaacacgtg ttgttcaggg ttttctaaag agattcctat tttcttggat      2220
     gcacaaatta cctattgcca cacggccaac aacatgacaa cgtcctatac agactatcct      2280
     gaagtgaaag gttcttgggg taatgatacc ctgggcttaa ctttgtctac tagcgtacct      2340
     atcccggtat ttagttcttc tatctttgat agttatgcac cgtttgcaaa attacaagtt      2400
     gtctatgcgc accaagatga ctttaaagaa ccaacaacag aaggccgggt ctttgaaagc      2460
     agcgatcttc tcaacgtttc tgtacctata ggtataaaat ttgagaaact ctcctatgga      2520
     gagagaagtg cttatgatct tacactgatg tatatacctg atgtgtaccg tcataatcca      2580
     agctgtatga caggattggc gatcaatgac gtttcctggt taaccacagc tacgaatctt      2640
     gctagacaag ctttcatagt tcgcgcgggt aaccatattg ccttaacctc tggtgttgag      2700
     atgttcagtc agtttggttt cgaattacga agctcttcaa gaaattataa cgtagatctt      2760
     ggcgctaagg tcgcgttcta a                                                2781
//

If you have problems or comments...

PBIL Back to PBIL home page