(data stored in SCRATCH zone)

EMBL: CR848038.PMP7G

CR848038.PMP7G       Location/Qualifiers
FT   CDS_pept        complement(304165..307239)
FT                   /transl_table=11
FT                   /gene="pmp7G"
FT                   /locus_tag="CAB269"
FT                   /product="polymorphic outer membrane protein"
FT                   /note="Similar to Chlamydia trachomatis probable outer
FT                   membrane protein PmpG precursor or ct871 SWALL:PMPG_CHLTR
FT                   (SWALL:O84879) (1013 aa) fasta scores: E(): 7.8e-72, 38.95%
FT                   id in 1068 aa and to Chlamydia pneumoniae probable outer
FT                   membrane protein Pmp13 precursor or omp14 or cpn0453 or
FT                   cp0299 SWALL:PM13_CHLPN (SWALL:Q9Z896) (973 aa) fasta
FT                   scores: E(): 2.6e-63, 37.57% id in 1046 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB269"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63725"
FT                   /db_xref="GOA:Q5L6J7"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR011427"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6J7"
FT                   /protein_id="CAH63725.1"
FT                   /translation="MKASFRKFLVSTTLTLPCSFQAFSLEIVVPNGTYNGDLREMFPYT
FT                   ITSNPEGTTAILSGNLNILNLDNSMAATPSSCFFNSAGSMTIIGKGHDVTFTNLRTSVN
FT                   GAALSSLITSSPESFSYTITGVKTFSCSNCSALLGRNNSNSILSPKGGAVYSKSPIFFK
FT                   NIQNLIFKDNCAADNGGALWGQVVDISNVTKSLKFLSNVGANGGAIGASTSLNVTRCPS
FT                   ILFRSNSASRLGGAIHSVNPQTPPPPPPPGNGVINTVVNFSDNGSVQFDSNNAKSGGAI
FT                   YSKGNINFSNNVQLLMQNNTASPEIGDSNEVLGQGGAIYCTQATATKKAAPVFTGLTIT
FT                   NQHDIFFANNFAANAGGAIYGEKVSITSSGRTVFTNNTAKTGGAIYIADNGELSLSADY
FT                   GNMTFYDNLNTNGGSPKRNAVTLGKGATIKLLAASGDHKLCFYDPIVTTLPEKAPNGSN
FT                   TLTINPDRGNSAPFTNYIGTVLFSGAHANAESAPNASTIYQKVILGGGKLVLADKASLS
FT                   VVSFDQQSDSILLMDNGTSLTITEHSYATSSEAVAAAASVVTAAEVSSVTSSTAATAAS
FT                   VTNQANSDGVVSIKDLHINLGSLTQDGEGAKIETKNTSGTITISEHISLDDVSGNAYEN
FT                   HDIFNRNTVTLKVLSLSTAGDNKITESDLQLTPRGDADPQYGYQGSWKLSWENGTNGDA
FT                   QKKKVLKATWTKTGFVPSPERQASLVPNSLWGAFIDLRSMNALATASCDGFGYGKGLWV
FT                   AGISNVFHHDRNCVSHGFRRISGGYVIGANSQTLSDSVFGVAFSQVFGKSKDYVVSTTK
FT                   SQAIAGSAYLSIKRPLSNTIFTTFAARINYSHTNEDMKTRYTFIPEASGNWDNNCWLGE
FT                   VGGSLPIVLQTTKLHLNQFVPFVNVQIGYAEHGSFREQLAEARSFCSSRLINLAIPCGF
FT                   KIDRRSHSYPDFYSLAVSYVPDVWRRNPGCTTLLLANGARWKTPATNLDRQGLLIEGSS
FT                   HTAVNNNIEIFSHGSCELRESSRNYNINVGSKFRF"
     atgaaagcgt ctttccgtaa gttcttagtt tctacaacgc tgactcttcc ttgttcattc        60
     caagcctttt ctttggaaat tgtagttcct aacggaactt ataacggcga tcttagagaa       120
     atgtttccct atacgataac gtctaatcca gaaggaacaa cagcgatcct ctcaggaaac       180
     ttgaatattt taaatctcga caactccatg gcggcaactc cttcaagttg ctttttcaat       240
     tccgctggat caatgaccat tatcggaaaa ggccatgatg taacttttac taatcttcgc       300
     acatcggtaa acggtgctgc tttaagctct cttattacgt cgagtcctga atcgttctct       360
     tataccatca caggagtcaa gaccttctcc tgctctaatt gttccgcatt actcggacgt       420
     aacaattcaa acagtattct atctcccaaa ggcggtgcgg tatattctaa gtcacctata       480
     ttcttcaaaa acatccaaaa cttaatattt aaggataact gtgcagcgga caatggtgga       540
     gctctatggg gacaagtagt tgacattagc aatgtaacaa aatcattaaa gtttctaagt       600
     aacgtgggcg ccaatggagg tgctatagga gcttctacaa gtctgaatgt cacgcgttgc       660
     ccatccattc tttttagatc caattctgca agcaggctcg gtggcgccat ccactccgtg       720
     aatccacaaa ccccgccacc tccaccacct cctggaaatg gggttataaa cactgtggtc       780
     aacttctcag acaacggctc tgtacaattt gactctaata acgctaaatc tggcggcgct       840
     atttactcta aagggaatat caacttctcg aacaacgtac aattgctcat gcagaacaac       900
     actgcatctc ctgaaatcgg agattctaat gaagtattag gacaaggagg agcaatttat       960
     tgtactcagg caacggcaac aaagaaagca gcccccgtct tcactgggtt aactataaca      1020
     aaccaacacg atatcttctt tgctaataac ttcgcagcaa atgctggcgg agccatttat      1080
     ggagaaaaag ttagcatcac ttcttcaggg agaacggtgt ttactaacaa taccgcaaaa      1140
     actggtggag caatctatat tgctgataat ggagagctaa gcctatccgc tgactacggc      1200
     aatatgactt tctatgacaa cctcaacacc aatggtggat ctcccaaaag aaatgccgtt      1260
     actctaggaa agggagcgac cattaaatta cttgccgctt ctggagatca taaactctgt      1320
     ttctatgatc ctattgtaac tactcttcct gaaaaagctc ctaatggcag taacacccta      1380
     acgatcaacc cagatagagg aaattctgct ccctttacta attatattgg aacagtgctc      1440
     ttttctggag ctcatgcaaa cgcagaaagt gctcccaacg catcaactat ttatcaaaaa      1500
     gtgattctag gtggtgggaa actcgtctta gcagataagg ctagcctatc tgtggtctcc      1560
     tttgatcaac aatctgattc tatcctcctc atggataatg ggacctcctt aactattaca      1620
     gagcattcct atgctacttc tagtgaggca gttgcagcag ctgcctctgt tgtgactgct      1680
     gctgaggtaa gtagcgttac ctcgtcgact gcagctactg cggcctctgt aaccaatcaa      1740
     gcgaatagcg acggagttgt ttccataaag gatctccata tcaatcttgg ttcgctgaca      1800
     caagatggag aaggagcaaa aattgaaaca aaaaatacaa gtggtacaat tacaatctct      1860
     gaacacattt ctttagacga tgtttctggg aatgcttatg aaaatcacga catcttcaat      1920
     cgaaatacag tcacgctcaa agtcctttct ctatccacag caggtgataa taaaatcacg      1980
     gaaagtgatc tccagctcac cccaagagga gatgcagatc ctcaatatgg gtaccaaggc      2040
     tcatggaaac tgagttggga aaacggaaca aatggagatg ctcagaaaaa gaaagtatta      2100
     aaagctactt ggacaaaaac tggatttgtt cccagcccgg aacgtcaagc ttctttagtt      2160
     cctaatagct tatggggcgc cttcatagat ctacgctcta tgaacgcact cgctacagca      2220
     agctgcgacg gctttggcta cggcaaagga ttatgggtag cgggaatttc gaacgttttc      2280
     catcatgatc gcaattgtgt atctcatggt ttccgccgta ttagtggtgg ctacgttatc      2340
     ggagcaaatt cacaaacact atcggattct gtatttggag tagctttctc tcaggtattc      2400
     ggaaaatcta aagactacgt ggtctccaca acaaaatcac aagctatagc aggtagtgct      2460
     tatctatcta taaaacgccc attaagcaac acgatcttca ctacgttcgc tgcaagaatc      2520
     aactacagcc atacgaatga agatatgaaa acacgctata ccttcatccc tgaagcaagc      2580
     ggtaattggg ataacaattg ctggttagga gaagtaggtg gaagcttgcc tattgttttg      2640
     caaacgacta aattacacct aaatcaattc gttccttttg tgaacgttca gattggttac      2700
     gcagaacatg gctccttcag agaacagctc gctgaagcac gatctttctg ttcttctcgt      2760
     ttaattaacc tagcgattcc ttgtggtttt aaaatagata gacgttctca ctcctacccg      2820
     gatttctaca gcttagctgt atcctatgtt cctgatgtgt ggaggagaaa ccccggatgt      2880
     acaacgttat tattagcaaa cggagctagg tggaaaactc ctgcgacaaa cctggataga      2940
     caaggtttgt taattgaagg gtcttctcac acagccgtaa ataataatat tgaaatcttt      3000
     agccatggta gttgcgaact acgtgaatct tcgcgcaatt acaatataaa tgtaggaagt      3060
     aaatttcgat tctaa                                                       3075
//

If you have problems or comments...

PBIL Back to PBIL home page