(data stored in SCRATCH zone)

EMBL: CR848038.RADA

CR848038.RADA        Location/Qualifiers
FT   CDS_pept        complement(385800..387167)
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="CAB333"
FT                   /product="DNA repair protein"
FT                   /note="Similar to many including: Lactococcus lactis DNA
FT                   repair protein RadA or ll2064 SWALL:Q9CDY7 (EMBL:AE006436)
FT                   (453 aa) fasta scores: E(): 1.9e-73, 46.57% id in 453 aa,
FT                   Chlamydia trachomatis DNA repair protein RadA or ct298
FT                   SWALL:RADA_CHLTR (SWALL:O84300) (454 aa) fasta scores: E():
FT                   6.2e-128, 74% id in 454 aa, and to Bacillus subtilis DNA
FT                   repair protein RadA or smS SWALL:RADA_BACSU (SWALL:P37572)
FT                   (458 aa) fasta scores: E(): 1.8e-74, 44.83% id in 455 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB333"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63782"
FT                   /db_xref="GOA:Q5L6E4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q5L6E4"
FT                   /protein_id="CAH63782.1"
FT                   /translation="MPMTTKIKIQWTCNECGTQTPKWLGQCPGCLQWNTLIEEQVSPHR
FT                   SKKRLEPQATAVSLHTVELREEERLCIGDPGWDRILGGGAVRGSLTLLGGDPGIGKSTL
FT                   LLQTAAKFADRGHKVLYVCGEESVTQTSLRARRLKISHTNIYLFPETNLDDIKQQIATL
FT                   QPDILIIDSIQIVFTPTLHSSPGSVAQVREVTSELMHMAKQSQITTFVIGHVTKSGEIA
FT                   GPRVLEHLVDTVLYFEGNSHANYRMIRSVKNRFGPTNELLILSMHAEGLKEVTNPSGLF
FT                   LQEKITETTGSAIIPIIEGSATLLIEMQALASSSPFANPIRKTSGFDQNRFLLLLAVLE
FT                   KRAQIKLHTADVFLSIAGGLKITEPAADLGAGLAVVSSLYNRLSPQNYTFTGEIGLGGE
FT                   IRHVTHLERRLKESKLMGFEGAVIPEGQIAGLSSEMKNSLDIREVKTIKDAIRLLQ"
     atgcccatga ctacgaagat aaaaatacaa tggacttgta atgaatgcgg cactcagacg        60
     cctaaatggt taggtcaatg cccaggatgt ttacaatgga atacactgat tgaagaacag       120
     gtttctcctc atcgaagtaa gaaaagactc gaaccgcaag ccacggcagt atctttgcat       180
     actgtagagc tgcgagagga ggaacgtttg tgtataggag atcctggatg ggaccgcatt       240
     ttgggtgggg gtgctgttcg tggaagtctg actctattag gtggggatcc tggcataggc       300
     aaatctacgt tgcttttaca gacagcagcg aaatttgctg atcgcggtca taaagtcctg       360
     tatgtctgtg gtgaggagtc tgtaacgcaa acatcattac gcgcacgtcg cttaaaaatt       420
     tctcatacga atatctacct tttccctgag acgaatcttg atgatatcaa acagcaaatc       480
     gcgacactcc agcctgacat cttaattatt gattctattc agattgtatt tactcctacc       540
     ttacattctt ctccaggatc tgtagctcaa gtacgtgaag tgacttctga gctgatgcac       600
     atggctaagc aatcccaaat cacaactttt gttattggtc atgtaacaaa atctggagaa       660
     attgccggtc ctagagtctt agaacatctt gtggatactg ttttgtattt tgaagggaac       720
     tcacatgcaa attatcgtat gatacgttct gtgaaaaatc gtttcggccc cacaaatgaa       780
     ttactgattt tatctatgca cgctgagggt ttaaaggaag tcactaatcc ttctgggcta       840
     tttctacaag aaaaaattac ggagaccaca ggttcggcga ttattcctat tattgagggt       900
     tcggcaaccc tgctcattga gatgcaagct ttagcttcat cttctccttt tgccaatcct       960
     attaggaaaa cctcaggatt cgatcaaaat cgatttttat tactcttagc tgtcctagaa      1020
     aagcgcgctc aaataaaatt gcatactgct gatgtttttc tttcgatagc tggaggatta      1080
     aaaattactg aacctgctgc agatttagga gcaggacttg ctgtagtctc ttctttatat      1140
     aatcgtcttt ctccccaaaa ttatacgttt acgggggaga tcggcctagg aggcgaaatc      1200
     cgtcatgtta cgcatttaga gaggcgtctt aaagaaagta aactcatggg ttttgagggt      1260
     gctgtaattc ctgaagggca aatcgcagga ttatcttcag aaatgaaaaa tagcttagat      1320
     attcgagagg taaaaacgat aaaagatgct atccgattgt tacaataa                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page