(data stored in SCRATCH zone)

EMBL: CR848038.RNC

CR848038.RNC         Location/Qualifiers
FT   CDS_pept        complement(387127..387840)
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="CAB334"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="Similar to Bacillus subtilis ribonuclease III or
FT                   RncS SWALL:RNC_BACSU (SWALL:P51833) (249 aa) fasta scores:
FT                   E(): 2.4e-21, 37.44% id in 219 aa and to Chlamydia
FT                   pneumoniae ribonuclease III Rnc or cpn0054 or cp0721
FT                   SWALL:RNC_CHLPN (SWALL:Q9Z9C7) (237 aa) fasta scores: E():
FT                   1.3e-67, 72.57% id in 237 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB334"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63783"
FT                   /db_xref="GOA:Q5L6E3"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6E3"
FT                   /protein_id="CAH63783.1"
FT                   /translation="MNNLINIKEVEAKLNFTFTQPKLLVTALTHPSYRNETATITEDSE
FT                   RLEFLGDAVLCLIVTEHLFLLFPSMDEGTLSTARAALINAVSCCQYTDALGLGEYLLIG
FT                   KGERIQNERGKTSAYANLFEAILGAVYLDGGLAPARQITVPLLPSKKDILPLMLGNPKN
FT                   RLQQLTQKHLRTLPVYQYEPWTSPQGASGYHIRVLVNHEVWGEGFALSKKEAEKLAAQQ
FT                   ALDAHDYEDKNTMDL"
     atgaataatc tgatcaatat taaagaagtt gaagctaaat taaattttac atttactcaa        60
     ccgaaactct tagttacagc tctcactcac ccttcttata ggaacgagac tgcaactatt       120
     accgaagaca gcgagcgttt ggaattctta ggagacgccg tgttatgttt aatcgtaact       180
     gaacacttat tcctattatt cccttctatg gatgagggaa ctttatccac ggcacgcgca       240
     gctttgataa atgctgtttc ttgctgtcaa tatactgacg cattaggatt aggagaatat       300
     ctacttatag gtaaggggga aagaatccaa aatgagcgag gcaaaacttc agcctatgca       360
     aatttattcg aggcgatttt aggtgcggtg tatctagatg gtggtttagc tccagcaaga       420
     caaatcactg tgcctttatt gccttcaaaa aaggatattc ttcccctgat gcttggaaac       480
     cctaaaaatc gtttacaaca gcttacacaa aaacacttac gtacgttacc tgtatatcaa       540
     tatgagccgt ggacatcacc acaaggtgct tcagggtatc atattcgcgt actagtgaat       600
     catgaggttt ggggtgaagg atttgcctta tcaaaaaaag aagcagagaa acttgctgct       660
     caacaagctt tagatgccca tgactacgaa gataaaaata caatggactt gtaa             714
//

If you have problems or comments...

PBIL Back to PBIL home page