(data stored in SCRATCH zone)

EMBL: CR848038.RPLF

CR848038.RPLF        Location/Qualifiers
FT   CDS_pept        114885..115436
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="CAB106"
FT                   /product="putative 50S ribosomal protein l6"
FT                   /note="Similar to Chlamydia muridarum 50S ribosomal protein
FT                   l6 RplF or tc0801 SWALL:RL6_CHLMU (SWALL:Q9PJM8) (183 aa)
FT                   fasta scores: E(): 1.4e-56, 83.6% id in 183 aa, and to
FT                   Guillardia theta chloroplast 50S ribosomal protein l6 rpl6
FT                   SWALL:RK6_GUITH (SWALL:O46908) (179 aa) fasta scores: E():
FT                   2.2e-28, 49.17% id in 181 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB106"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63564"
FT                   /db_xref="GOA:Q5L706"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L706"
FT                   /protein_id="CAH63564.1"
FT                   /translation="MSRKARDPIVLPQGVEVSIQNNEILVKGPKGSLKQVLAPEVVIDI
FT                   KGREVFVHPAPYVVDRPSRMQGLFWALISNMVQGVSVGFEKRLEMIGVGFRASVQGSIL
FT                   DLSIGVSHPTKIPIPADIQVSVEKNTIISVKGINKQLVGEFAANIRAKRKPEPYKGKGI
FT                   RYENEYVRRKAGKAAKTGKK"
     atgtctcgta aagctcgaga ccctattgtg ctccctcaag gagtagaggt ctccattcaa        60
     aataatgaaa tcttggtaaa aggtcctaag ggctctttaa aacaagtatt agctccagaa       120
     gtagtcatcg acataaaagg tagggaggtt tttgttcatc ctgctcctta tgtggttgac       180
     agaccaagtc gcatgcaagg tttattttgg gcattaattt ccaatatggt tcaaggggtt       240
     agtgtaggat tcgagaagcg tttggaaatg ataggggttg gttttagagc ttccgttcaa       300
     ggatctattt tagatttgtc tattggggtt tctcatccta cgaagattcc tatccctgca       360
     gatattcaag tgagtgttga aaagaatacg ataatatctg tgaaggggat aaataaacag       420
     ttagttgggg aattcgctgc taatatccgt gctaaacgta aacctgagcc ctataaaggt       480
     aagggtatcc gctatgaaaa cgagtatgtc cgtcgtaagg ctggaaaagc ggcaaaaaca       540
     ggtaaaaaat ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page