(data stored in SCRATCH zone)

EMBL: CR848038.RPOA

CR848038.RPOA        Location/Qualifiers
FT   CDS_pept        119032..120162
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="CAB113"
FT                   /product="putative DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Chlamydia trachomatis DNA-directed RNA
FT                   polymerase alpha chain RpoA or ct507 SWALL:RPOA_CHLTR
FT                   (SWALL:Q46449) (377 aa) fasta scores: E(): 1.5e-124, 84.88%
FT                   id in 377 aa, and to Bacillus subtilis DNA-directed RNA
FT                   polymerase alpha chain RpoA SWALL:RPOA_BACSU (SWALL:P20429)
FT                   (314 aa) fasta scores: E(): 3.6e-23, 39.57% id in 331 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB113"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63571"
FT                   /db_xref="GOA:Q5L6Z9"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6Z9"
FT                   /protein_id="CAH63571.1"
FT                   /translation="MSDCSQNLLYDKFELPESVKMMAVEGSGGSVDKQASFIAEPLERG
FT                   MGHTLGNALRRALLIGLEAPAIISFSMTGVLHEYMAINGIIEDVTNIILNLKGALLKKY
FT                   PFQDSENGRCTQLLKSKVSIDASDLAACGGQKAVTLADLLQEGGFESVNPDYVIFTVTQ
FT                   PMQLDITLRVAFGRGYTTSERIVLEDKGVNEIVLDAAFSPVVLVNYFVEDTRVGQDTDF
FT                   DRLILHVETDGRVSPKEALAFSTQILTKHFSIFEKMDEKKIVFEEAISLEKENKDDILH
FT                   KLVLGINEIELSVRSTNCLSNANIETIGELVIMPEPRLLQFRNFGKKSLCEIKNKLKEM
FT                   KLELGMDLSQFGVGLDNVKEKMKWYADKIRSKNGKG"
     atgtcggatt gttcacaaaa tttactttac gataaatttg aattgccaga gtcagtcaaa        60
     atgatggctg tagaaggtag cgggggatca gttgataagc aggcgagttt catagcagag       120
     cctttagaaa gaggtatggg tcatacttta ggtaatgctt tgagaagagc tttgctcata       180
     ggtttagaag ctcctgcaat tatttctttc tctatgactg gtgtgcttca tgagtacatg       240
     gcaattaacg gaattataga agatgtaaca aatattatct tgaatttgaa gggagcttta       300
     ttaaagaagt atcctttcca agacagtgaa aatggccgtt gtactcaatt attaaagtct       360
     aaagtttcta tagacgcttc tgatttagct gcctgtggtg gtcagaaagc tgttacattg       420
     gctgatttgt tgcaagaagg cgggtttgaa tccgtgaacc ccgattatgt gattttcact       480
     gtgacacagc ctatgcaatt agatattact ttaagagttg cttttggcag aggttatact       540
     acatctgaaa gaattgtcct tgaggataag ggtgtaaatg aaattgtttt agacgcagct       600
     ttctcacccg ttgtcttggt aaattacttt gtagaagata ctcgtgtcgg tcaagataca       660
     gatttcgatc gtttgatttt gcatgtagaa acagatggta gagtatcccc taaggaagct       720
     ttagcctttt ctacacaaat tttaaccaag catttctcca tttttgaaaa aatggatgaa       780
     aagaagattg tctttgaaga agccatttct ctcgaaaaag aaaataaaga cgatattctt       840
     cataagttag ttttaggtat taacgagatc gagttatctg taagatccac aaactgtttg       900
     tctaatgcaa acattgaaac cataggggaa ttggtgatta tgccagagcc tcgcttgcta       960
     cagttcagaa actttggtaa aaagtctctc tgtgagatta aaaacaagtt aaaagaaatg      1020
     aagttagaat tgggcatgga tcttagtcag ttcggcgttg gtttggacaa cgtaaaagaa      1080
     aaaatgaagt ggtatgccga taagattcgg tctaaaaacg gtaagggata a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page