(data stored in SCRATCH zone)

EMBL: CR848038.RPSS

CR848038.RPSS        Location/Qualifiers
FT   CDS_pept        110918..111184
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="CAB097"
FT                   /product="putative 30S ribosomal protein s19"
FT                   /note="Similar to Chlamydia pneumoniae 30S ribosomal
FT                   protein s19 RpsS or Rs19 or cpn0643 or cp0104
FT                   SWALL:RS19_CHLPN (SWALL:Q9Z7R1) (88 aa) fasta scores: E():
FT                   2.7e-34, 95.45% id in 88 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB097"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63554"
FT                   /db_xref="GOA:Q5L716"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L716"
FT                   /protein_id="CAH63554.1"
FT                   /translation="MSRSLRKGPFVDHSLIKKVRAMNLLEKKTPIKTWSRRSMITPEMI
FT                   GHTFEVHNGKKFLTVFVSETMVGHKLGEFSPTRIFKSHPVKKG"
     atgagtagat cgttaagaaa gggtcctttt gttgatcaca gtctgataaa aaaagtacgt        60
     gctatgaact tattggagaa aaaaactcca attaaaacct ggtctcgtcg ttctatgatt       120
     acccctgaaa tgataggcca tacatttgaa gttcataacg ggaaaaagtt tctaacagtg       180
     tttgtttcgg aaactatggt aggacacaag ttgggagaat tttcaccaac aagaatattt       240
     aaaagtcatc ccgtgaagaa agggtaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page