(data stored in SCRATCH zone)

EMBL: CR848038.XSEB

CR848038.XSEB        Location/Qualifiers
FT   CDS_pept        complement(353028..353255)
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="CAB303"
FT                   /product="probable exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="Similar to Chlamydia pneumoniae probable
FT                   exodeoxyribonuclease VII small subunit XseB or cpn1061.1 or
FT                   cp0788 SWALL:EX7S_CHLPN (SWALL:Q9K1Y4) (75 aa) fasta
FT                   scores: E(): 1.1e-16, 75.67% id in 74 aa, and to Zymomonas
FT                   mobilis probable exodeoxyribonuclease VII small subunit
FT                   XseB SWALL:EX7S_ZYMMO (SWALL:Q9RME6) (81 aa) fasta scores:
FT                   E(): 0.00042, 35.59% id in 59 aa"
FT                   /db_xref="EnsemblGenomes-Gn:CAB303"
FT                   /db_xref="EnsemblGenomes-Tr:CAH63753"
FT                   /db_xref="GOA:Q5L6H2"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5L6H2"
FT                   /protein_id="CAH63753.1"
FT                   /translation="MEEITFEKAMERLEEIVDLMNQPSTSLDASLKFYEEADALMRICE
FT                   SRIRKAEERVRELSEKRNEDFLSEEESFVH"
     atggaagaaa ttacctttga aaaggctatg gaaaggttag aagagatcgt agatctcatg        60
     aatcaacctt cgacatcttt agatgcttct ttaaaatttt atgaagaagc agatgcccta       120
     atgcgtatat gtgaatcacg gatccgtaaa gcggaagagc gtgtacgtga gttgtctgaa       180
     aaacgaaatg aagattttct ttcagaagaa gagtctttcg tacactaa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page