(data stored in ACNUC7421 zone)

EMBL: CR954246.ACCB

CR954246.ACCB        Location/Qualifiers
FT   CDS_pept        278350..278814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="PSHAa0265"
FT                   /product="Biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase (BCCP)"
FT                   /function="2.4.1 : Fatty acid and phospholipid metabolism"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12794081, 1370469; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85364"
FT                   /db_xref="GOA:Q3IDT0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT0"
FT                   /protein_id="CAI85364.1"
FT                   /translation="MDIRKIKKLIELVEESGIAELEITEGEESVRINRNNMSAGPGYAQ
FT                   FAPQQYAPAPVAAPVAAAPAAAVEAAAPAASTGHQVKSPMVGSFYAAASPEAPAYVEVG
FT                   SQVKVGDTLCIIEAMKMMNQIESDKAGTVKAILAENGEPIEFDQPLFIIE"
     atggatattc gcaagatcaa aaaacttatt gaattagtag aagagtcagg tattgctgag        60
     ctagaaatca ctgaaggtga agagtcagta cgtataaatc gtaataacat gagtgcaggc       120
     ccaggctatg ctcagtttgc gccacagcaa tatgcaccag caccagttgc cgctccagtt       180
     gctgcagctc ctgcagcagc agttgaagcc gctgctccag cagcctctac aggtcatcaa       240
     gttaaatcac ctatggttgg ctcattctac gctgcagctt caccagaagc accagcatac       300
     gtagaagttg gttctcaagt taaagttggc gatacattat gtatcatcga agcaatgaaa       360
     atgatgaacc aaattgagtc agacaaagct ggtacagtaa aagctatttt agctgaaaat       420
     ggcgagccaa tagaatttga tcaaccttta ttcatcattg aataa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page