(data stored in ACNUC7421 zone)

EMBL: CR954246.ACCC

CR954246.ACCC        Location/Qualifiers
FT   CDS_pept        278841..280181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="PSHAa0266"
FT                   /product="biotin carboxylase (A subunit of acetyl-CoA
FT                   carboxylase)(ACC)"
FT                   /function="2.4.1 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="6.3.4.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1682920, 1370469; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85365"
FT                   /db_xref="GOA:Q3IDS9"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS9"
FT                   /protein_id="CAI85365.1"
FT                   /translation="MLDKVVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLA
FT                   DETICIGKPAATESYLDIPRIIAAAEITDAVAIHPGYGFLAENADFADQVEQSGFVFIG
FT                   PTGDTIRLMGDKVSAIAAMRKAGVPCVPGSDGPVSDDKERNMQIAKRIGYPVIIKAAGG
FT                   GGGRGMRVVRSEAELIDSIALTQQEAKQFFGNGMVYMEKYLENPRHIEVQILADGQGNA
FT                   VHLGERDCSMQRRHQKVVEEAPAPGITAETRKFIGERCTRACIEIGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHTITEMVTGIDLVKEQLKIAAGQPLSFTQDDVVIRGHAIECRIN
FT                   AEDPETFIPSPGKITRFHPAGGLGIRWDSHIYADYTVPPHYDSMIGKLITYGENRDVAI
FT                   ARARNALNELVIDGIKTNTPLHKRILADENFQNGGTNIHYLEKKLGL"
     atgttagata aagtagtcat tgcaaaccga ggtgaaattg cacttcgtat attgcgcgcc        60
     tgcaaagagc ttgggatcaa aacggttgct gtgcattcaa cggcggatcg cgatcttaag       120
     catgtattgc ttgcagatga aaccatctgt attggtaaac cagcagcaac agaaagttat       180
     ttagatattc cgcgtattat tgccgcggct gaaataactg acgctgtagc gattcatcct       240
     ggttatggtt ttcttgcaga aaatgctgat tttgccgatc aagttgagca aagtggtttt       300
     gtatttattg gtcctactgg cgatacaatt cgtcttatgg gcgataaagt atctgcaatc       360
     gcagcaatgc gtaaagcagg tgttccgtgt gtaccaggct cagatggtcc agtatcagat       420
     gacaaagagc gcaatatgca aattgctaag cgcattggtt atccggtaat cattaaagcc       480
     gctggtggcg gtggtggtcg tggtatgcgt gttgtgcgca gcgaagctga actgattgat       540
     tcaattgcat taacccagca agaagcgaag cagttctttg gtaatggcat ggtttacatg       600
     gagaaatacc ttgaaaaccc acgtcatatc gaagtacaaa ttttagctga tggccaaggt       660
     aatgctgtgc atttaggtga acgtgattgt tctatgcagc gtcgtcacca aaaagtagtt       720
     gaagaagcac ccgctccagg aattacagca gaaacacgta aatttattgg tgagcgctgt       780
     acgcgtgcct gtattgaaat tggttatcgt ggagctggta cgtttgagtt tttatacgaa       840
     aacggcgagt tttattttat cgaaatgaat acccgtattc aggttgagca tacaatcact       900
     gaaatggtta caggtattga tttagttaaa gaacagctaa aaattgcggc tggtcagcca       960
     ttgtcgttca ctcaagatga tgttgttatt cgcggccatg caattgaatg tcgtattaac      1020
     gcagaagacc cagaaacctt tattccgtca ccgggtaaaa ttacacgttt tcatcctgcg      1080
     ggtggtttag gtattcgttg ggacagccat atttatgctg actacacggt tccaccacat      1140
     tacgattcaa tgattggtaa gctaattact tacggtgaaa accgtgacgt agcaattgct      1200
     cgtgcacgta acgcactaaa tgaattagta atcgacggta ttaaaaccaa tactccgctg      1260
     cataaaagaa ttcttgcaga cgaaaacttc caaaatggtg ggactaatat ccactatctt      1320
     gagaaaaaat tgggactata a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page