(data stored in ACNUC7421 zone)

EMBL: CR954246.ACEE

CR954246.ACEE        Location/Qualifiers
FT   CDS_pept        404449..407115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="PSHAa0391"
FT                   /product="pyruvate dehydrogenase, decarboxylase subunit,
FT                   thiamin-binding"
FT                   /function="2.1.1.5 : Pyruvate dehydrogenase and
FT                   input/output into the TCA cycle"
FT                   /EC_number="1.2.4.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6343085; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85489"
FT                   /db_xref="GOA:Q3IIH8"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH8"
FT                   /protein_id="CAI85489.1"
FT                   /translation="MSEVNKIDVDALETQEWLQALESVVREEGVERAQFLLEQVLEQAR
FT                   LDGVDMPTGITTNYVNTIPVEQEPAYPGDVNIERRIRSIIRWNAIMIVLRASKKDLDLG
FT                   GHMASYQSSAAFYEVCFNHFFKAPNDVDGGDLVYYQGHISPGIYARAFVEGRLSASQLD
FT                   NFRQEVGGEGLPSYPHPKLMPEFWQFPTVSMGLGPISSIYQARFLKYLDGRGLKDTKNQ
FT                   RVYAFLGDGEMDEPESRGAISFAAREKLDNLCYLVNCNLQRLDGPVMGNGKIIQELEGL
FT                   FKGAGWNVIKLVWGSGWDILLAKDKTGKLLQLMNETVDGDYQTYKAKNGAYVREHFFGR
FT                   YPETAALVADMTDDEIFALKRGGHEPSKLFAAFKKAEETKGRPTVILAKTVKGYGMGEA
FT                   AEGKNIAHQVKKMDMSHVAHLRSRLGLDDLISEEQLTELPYLTLEEGTPEHTYLHARRE
FT                   ELKGYTPKRIARFSEKLTVPEVEAFNPLLEEQKRDISTTMGFVRALNILLKDKGIGKNI
FT                   VPIIADEARTFGMEGLFRQIGIYNPHGQNYTPQDRDIVSYYKEATSGQVLQEGINELGA
FT                   MSSWVAAATSYSTNDLPMIPFYIYYSMFGFQRVGDMAWMAGDQQARGFLLGATAGRTTL
FT                   NGEGLQHEDGHSHILASTVPNCISYDPTYAYEVAVIIQDGIRRMYGDDQENIYYYLTLM
FT                   NENYHQPAMPEGAEEGIRKGIYKLESYAGKKANVQLLSSGTIMTEVRKAAKVLSEDYGV
FT                   ASDVFSVTSFNELTRDGQDVERFNMLNPEGEQKTAYITSVLNDSVTVAATDYMKNYAEQ
FT                   ARSFIPSNNYKVLGTDGYGRSDSRENLRRHFEVNADYVVVATLSELAKRGEVEKSVVIE
FT                   ALKKFNIDTNKLNPLYA"
     atgtctgaag tcaataaaat tgacgtagac gcgctagaaa cacaagagtg gttacaagct        60
     cttgaatcgg ttgtgcgcga agaaggtgtt gaacgagctc agtttttact tgagcaagtg       120
     ttagagcaag cccgtttaga tggcgtagat atgccaacgg gtattaccac taactacgtc       180
     aatacaattc cggtagagca agaacctgct tacccgggag atgtaaatat tgaacgccgt       240
     attcgttcaa taattcgttg gaacgcgata atgattgtat tgcgtgcatc gaaaaaagat       300
     ctcgatttag gcggccatat ggcgtcttac caatcgtctg cggcatttta tgaagtgtgt       360
     tttaaccact tttttaaagc accaaacgat gtagacggtg gcgacttagt ttattaccag       420
     gggcatattt ctccgggtat ttatgcacgc gcatttgtag aagggcgttt atcggcatcg       480
     cagctagata acttccgtca agaagtaggt ggcgaaggtt taccgtcgta cccgcatcct       540
     aaattaatgc ctgaattttg gcagtttcct acggtttcta tgggccttgg tcctatttcg       600
     tctatttacc aagcacgctt tttaaaatac ctagacggcc gtggcttaaa agacactaaa       660
     aaccaacgtg tatatgcgtt tttaggtgat ggcgaaatgg atgagccaga atcacgtggc       720
     gctatttcat ttgctgcacg cgaaaagcta gacaacctat gttacttagt taactgtaac       780
     ttacagcgcc tagatggccc agttatgggt aacggtaaaa ttattcaaga gctagagggc       840
     ctatttaaag gcgctggctg gaacgtaatt aagttagtgt ggggcagcgg ttgggatata       900
     ttactggcta aagataaaac cggtaagtta ttacaactaa tgaacgaaac ggttgacggc       960
     gattaccaaa cgtataaagc aaaaaatggc gcgtatgttc gtgaacattt ctttggtcgt      1020
     taccctgaaa cagcagcact tgttgctgat atgacagatg acgaaatttt tgcgcttaag      1080
     cgtggtggtc atgagccatc taaattattt gctgcattta aaaaagcaga agaaaccaaa      1140
     ggtcgtccta ctgttattct tgctaaaacc gttaaaggtt acggcatggg tgaagcagct      1200
     gaaggtaaaa atattgcgca tcaagttaaa aaaatggaca tgtcgcatgt tgcacaccta      1260
     cgctcacgcc taggccttga cgatttaata tctgaagagc aactaaccga actgccttat      1320
     ttaacgcttg aagaaggcac tcctgagcac acttacttac acgctcgtcg tgaagagctt      1380
     aaaggttata cacctaagcg tattgcacgc tttagcgaaa agttaacagt gccagaagta      1440
     gaagcgttta atccgctact tgaagaacaa aaacgtgata tttctaccac tatgggtttt      1500
     gttcgtgctc ttaatatttt actaaaagac aaaggcattg gtaaaaacat agtacctatt      1560
     attgccgacg aagcacgtac ctttggtatg gaaggtttgt tccgccaaat tggtatttat      1620
     aacccgcatg gccaaaacta cacacctcaa gatcgcgata ttgtttctta ctataaagaa      1680
     gctacatcgg gtcaagtact gcaagaaggt attaacgagt taggtgcaat gtcgtcatgg      1740
     gttgctgcag caacatcgta cagcaccaac gatttaccaa tgatcccatt ttacatttac      1800
     tactctatgt ttggtttcca acgcgttggc gacatggcat ggatggcagg cgatcagcaa      1860
     gcacgtggtt tcttattagg tgcaacagcc ggtcgtacta cgcttaacgg cgaaggctta      1920
     caacacgaag atggccacag ccatattctt gccagcacag tacctaactg tatttcttac      1980
     gatccaacgt atgcatacga agtagcggtt atcattcaag atggtattcg tcgtatgtat      2040
     ggtgacgatc aagaaaacat ttactactac ttaacgttaa tgaacgaaaa ctaccatcag      2100
     ccagctatgc cagaaggcgc tgaagaaggt attcgtaaag gtatttacaa gctagaaagc      2160
     tacgcaggca aaaaagccaa cgtacagcta ttaagctcgg gtactattat gactgaagta      2220
     cgtaaagcag ctaaagtatt gagcgaagac tacggtgttg cgtctgacgt attctcagta      2280
     acgtctttca acgagctaac gcgcgatggc caagatgttg agcgctttaa catgcttaac      2340
     cctgaaggcg agcaaaaaac agcgtatatc actagcgtat taaacgattc agtaacggtt      2400
     gcagcaaccg attacatgaa aaactacgca gagcaagcgc gttcgtttat ccctagcaat      2460
     aactataaag tgttaggcac cgatggttac ggccgctctg atagccgcga aaaccttcgt      2520
     cgtcactttg aagttaacgc agactacgtt gtagttgcta cgttatctga acttgctaaa      2580
     cgtggtgaag ttgaaaagtc ggtagttatt gaagcactta aaaagttcaa tatcgacacc      2640
     aacaaactta acccactgta cgcataa                                          2667
//

If you have problems or comments...

PBIL Back to PBIL home page