(data stored in ACNUC7421 zone)

EMBL: CR954246.ACEF

CR954246.ACEF        Location/Qualifiers
FT   CDS_pept        407126..409090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="PSHAa0392"
FT                   /product="pyruvate dehydrogenase,
FT                   dihydrolipoyltransacetylase subunit"
FT                   /function="2.1.1.5 : Pyruvate dehydrogenase and
FT                   input/output into the TCA cycle"
FT                   /EC_number="2.3.1.12"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6345153; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85490"
FT                   /db_xref="GOA:Q3IIH7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH7"
FT                   /protein_id="CAI85490.1"
FT                   /translation="MSIEIKVPDIGGDEVEVTEILVAVGDVVEVDQALLTVEGDKASME
FT                   VPADTAGTVKEIKVSVGDNVATGSLVFIFEGESEGESADKSASADKSDSAAEQKTPATD
FT                   AKPAPAASGSTAQDVTLPDIGDDEVEVTEILVAVGDSVSEDQSILSVEGDKASMEVPAP
FT                   FAGTVKEIKVATGDTVKTGSLVFVFEVAGSESAAPAAESTPAETKAAPAAEQSSVSSTK
FT                   EVNVPDIGGDEVEVTEVLVAVGDSVTEDQSLLNVEGDKAAMELPAPFAGTVKEIKVATG
FT                   DKVSTGSLIFVFEVAGGAPAAAAKPEAEKSAPAAKSEKPAPKAETATQSAPAASNESFA
FT                   DNSAYAHASPVVRRLAREFGINLANVKGSGRKNRVVKDDVQNYVKNLVKQVESGQLSAD
FT                   KGNAGGSELGLIPWPKVDFAKFGEIEEKKLSRIQKLSGKNLHRNWVQIPHVTQFDEADI
FT                   TSLEEFRKEQNALNEKKKLGVKITPLVFVMKAAAKALAEFPTINSSLSNDGESLILKKY
FT                   INIGVAVDTPNGLVVPVFKDVDKKGIIELSRELMEVSAKARDGKLTSADMQGGCFTISS
FT                   LGGIGGTAFTPIVNAPEVAILGVSKSEMKPKWNGKEFEPKLMVPLSMSYDHRVIDGALA
FT                   ARFTVTLASYMSDIRQLVM"
     atgagtattg aaattaaagt acccgatatc ggtggtgatg aagtagaagt aaccgaaatc        60
     ttagtagccg ttggcgacgt tgttgaagtt gaccaagcat tactaaccgt tgaaggcgac       120
     aaagcatcaa tggaagtacc ggccgacacc gctggcacag taaaagagat taaagtaagc       180
     gttggcgaca acgtagctac tggatcttta gtgtttatct ttgaaggcga gagtgaaggc       240
     gaaagtgcag ataaaagcgc aagtgcagac aaaagcgaca gtgcagcaga gcaaaaaacg       300
     cctgcaactg acgctaagcc agcaccagcg gcttctggct ctacagcaca agacgtaacc       360
     ttgccagata ttggcgatga cgaagttgaa gtaactgaaa ttttagtagc cgttggtgac       420
     agcgttagcg aagatcagtc tattttaagc gttgaaggcg acaaagcatc aatggaagta       480
     cctgcgccat ttgctggcac agttaaagaa attaaagtag cgactggcga tacagtaaaa       540
     accggttcat tggtatttgt atttgaagta gcgggtagtg agtctgcagc accagctgct       600
     gagtcaacac cagccgaaac taaagcagca ccggcagccg agcaaagctc agtatcaagc       660
     acaaaagaag ttaacgtgcc tgatattggt ggcgacgaag ttgaagtgac cgaagtttta       720
     gtagccgttg gcgacagcgt tactgaagat caatcgttac taaacgttga aggcgacaaa       780
     gcagcaatgg agcttcctgc gccgtttgct ggcacagtta aagaaattaa agtagctact       840
     ggcgacaaag tatcgaccgg ctcgttaatt tttgtttttg aagttgctgg tggcgcacct       900
     gctgcagccg ctaaacctga agccgaaaaa tcagcacctg ctgctaaaag cgaaaagcca       960
     gcaccaaaag ccgaaacagc gacgcaatct gctccagcag ctagcaacga aagctttgct      1020
     gataacagcg cgtatgcaca tgcatcgcct gtggtacgcc gcttagcacg tgagtttggt      1080
     ataaacctag ctaacgtaaa aggctctggt cgtaaaaacc gcgtagtaaa agacgacgtg      1140
     caaaactatg ttaaaaactt agttaagcaa gttgaatctg gtcaattgtc ggcagataaa      1200
     ggtaacgcag gcggcagtga gcttgggctt attccatggc ctaaagttga ttttgctaag      1260
     tttggcgaaa ttgaagagaa aaaactatcg cgtattcaaa agctatcggg taaaaactta      1320
     caccgtaact gggtgcaaat cccacatgtt actcagttcg acgaagccga tataaccagc      1380
     cttgaagaat tccgtaaaga gcaaaatgcc cttaacgaga agaaaaagct aggtgttaaa      1440
     attacgccat tagtatttgt aatgaaagcc gcagcaaaag cattggccga atttccaact      1500
     attaactcgt cactgtctaa cgacggcgaa agcttaattc ttaaaaagta cattaatatt      1560
     ggtgtagcgg ttgatacgcc aaatggttta gtagtacctg tgtttaaaga tgttgataaa      1620
     aaaggcatta ttgaactatc gcgcgagcta atggaagtat cagctaaagc acgcgacggt      1680
     aagcttacct cggcagatat gcaaggtggc tgttttacta tttcaagctt aggcggtatt      1740
     ggcggtacgg catttacgcc gattgttaac gcgccagaag tggctatttt aggtgtgtct      1800
     aaatctgaaa tgaagccaaa atggaatggt aaagagtttg aaccaaaact tatggtgcca      1860
     ttgtcaatgt cgtacgacca tagagtgatt gacggtgcgc tagcagcacg ctttactgtt      1920
     acgctggcaa gctacatgag cgatattcgt caattagtga tgtaa                      1965
//

If you have problems or comments...

PBIL Back to PBIL home page