(data stored in ACNUC7421 zone)

EMBL: CR954246.ACNA

CR954246.ACNA        Location/Qualifiers
FT   CDS_pept        complement(167037..169781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="PSHAa0159"
FT                   /product="aconitate hydratase (likely to be used in
FT                   stationary phase); likely to have a 4Fe-4S cluster"
FT                   /function="2.1.2 : TCA and related cycles"
FT                   /EC_number="4.2.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12732309; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85263"
FT                   /db_xref="GOA:Q3IFL7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL7"
FT                   /protein_id="CAI85263.1"
FT                   /translation="MNNSFKTQQQLTVNGEQFHIHSLKGLGDKAKRLPFSLKILLENLL
FT                   RNEDGENIKEQDIQALLDWDPQAKPSAEVAFTPARVVMQDFTGVPAIVDLAAMRDAMEK
FT                   LGGDPAKINPLSPAELVIDHSVQVDGYGNEGAFDLNAKLEYDRNKERYEFLRWGQTAFD
FT                   NLKVVPPATGIVHQVNLEYLARVVFNDERNGQKYAYPDTLVGTDSHTTMINGLGVLGWG
FT                   VGGIEAEAAMLGQPISLLIPQVVGVKLNGRLPEGTTATDLVLTVTEMLRNHGVVGKFVE
FT                   FYGDGLADLPLADRATIANMAPEYGATCGIFPIDDETINYLRLTNRDEKQLKLIEDYAK
FT                   HQGLWRNDGDEANYTDKLELILDDVVPSLAGPKRPQDRISLDKAGEAISQHLKEFQDER
FT                   LAKISSSDTEQARIESEGPVTNPDESSNEAPFIGAAKVNFKGQEFELKDGACVIAAITS
FT                   CTNTSNPSVILAAGLVAKKAKQLGINVKPWVKTSLAPGSKVVTDYLEKAGLMDDLESLG
FT                   FNLVGYGCTTCIGNSGPLAPEISDAIQKHKLVVSSILSGNRNFEGRIHQDVKMNFLASP
FT                   PLVVAYAIAGRTDIDVYNEPLAQDANGNDIYLKNIWPSVKEVSDLVKETVTREMFEKSY
FT                   ANVYEGDSRWQKIQIPDGKLYDWDDASTYIKKAPFFDGMSIEPPGIPTITGARCLAKLG
FT                   DSVTTDHISPAGAIKADSPAGLYLQDNKVGQAQFNSYGSRRGNHEVMMRGTFANIRLKN
FT                   LLAPGTEGGVTRTQPDDELASIYDAAMEYQKNDTPLVILAGKEYGTGSSRDWAAKGSLL
FT                   LGVKAVIAQSYERIHRSNLIGMGVLPLQFKDGESHESLGLTGQEQFDIEGLFDKTKEVS
FT                   VIATNSEGKKVSFSADVRIDTPKEWDYYKHGGILQYVLRNMLD"
     atgaataata gtttcaaaac ccagcagcaa cttaccgtta atggtgagca gtttcatatt        60
     cactctctta aaggccttgg cgacaaagcc aaacgcttac ctttttcttt aaaaatacta       120
     ctcgaaaacc tacttcgtaa cgaagacggc gaaaacatta aagaacaaga cattcaagcc       180
     ctattagatt gggaccctca agctaaaccc tctgctgaag tagcgtttac gcctgcccgt       240
     gttgtgatgc aagactttac cggtgtacct gccattgtcg atttagcggc aatgcgcgat       300
     gcaatggaaa aactaggcgg cgatcctgca aaaattaacc cgctttctcc tgctgaactt       360
     gttattgacc actctgtgca agtagatggc tatggtaacg agggtgcgtt tgacttaaac       420
     gccaagcttg aatatgaccg taataaagag cgttatgaat ttttacgttg gggccaaact       480
     gccttcgata acttaaaagt tgtccctcca gcaaccggta ttgtgcacca agtaaattta       540
     gagtatttag cgcgcgttgt ttttaatgat gaacgtaatg gccaaaagta cgcgtaccca       600
     gacaccttag tgggtaccga ttcgcacacc actatgatta acggcttagg cgtacttggc       660
     tggggcgtag gcggcattga agccgaagcc gctatgcttg gccaacctat tagcttatta       720
     atacctcagg ttgtaggggt taaattaaac ggccgtttac cagagggcac cacagctacc       780
     gacttagtac ttaccgttac cgaaatgcta cgtaaccatg gtgtcgtagg taaatttgta       840
     gagttttatg gtgatggcct tgccgactta ccacttgccg atagagcaac aattgccaac       900
     atggcgccag aatatggtgc tacatgtggt attttcccga ttgatgacga aaccattaac       960
     tatctgcgtt taaccaaccg cgatgagaaa cagcttaaac ttattgaaga ttatgctaag      1020
     catcaaggct tatggcgtaa cgatggcgat gaagctaatt acaccgataa acttgaactg      1080
     atattagatg acgtagtacc aagccttgct ggccctaaac gcccacagga tagaatatca      1140
     cttgataaag ctggcgaagc aattagtcag catttaaaag agtttcaaga cgagcgttta      1200
     gcaaaaatta gcagcagtga tacagagcaa gcacgtatcg aaagcgaagg ccctgtaact      1260
     aatcctgacg aatcaagcaa tgaagcgccg tttataggcg cagcaaaagt aaactttaag      1320
     ggccaagagt tcgaactaaa agatggtgcc tgtgttattg ccgcaatcac tagttgtaca      1380
     aacacctcta accccagtgt tattttagcg gctggcttag ttgctaaaaa agccaagcaa      1440
     ttagggatta atgtaaaacc ttgggttaaa acatcacttg ctcctggctc taaggtcgtt      1500
     actgactact tagaaaaagc agggctaatg gacgatttag aaagcctagg ctttaactta      1560
     gttggctatg gttgtacaac gtgtattggt aactcaggcc cgctggctcc tgaaatttca      1620
     gatgctattc aaaagcacaa actggttgtg agctcaattt tatcgggtaa ccgtaacttt      1680
     gaagggcgta ttcaccaaga tgttaaaatg aactttttag catctcctcc gcttgttgta      1740
     gcttacgcca ttgcgggcag aaccgatatt gacgtatata acgaaccact ggcacaagat      1800
     gctaacggta acgatattta ccttaaaaac atttggccaa gtgttaaaga agtaagcgat      1860
     ttagttaagg aaacggtaac cagagaaatg ttcgaaaaaa gttatgctaa cgtatacgaa      1920
     ggcgatagcc gttggcaaaa aattcaaata cctgatggta aactttacga ttgggatgat      1980
     gcatcaacct atattaaaaa agcacccttt tttgatggta tgagtattga gcctccgggt      2040
     attccaacca ttaccggcgc acgttgttta gcaaaactag gtgactcggt tactacggat      2100
     catatttcgc cagccggtgc gattaaagca gactcaccag cagggttata tttacaagat      2160
     aacaaagtag ggcaagcgca gtttaactct tatggttcgc gtcgtggtaa ccacgaagta      2220
     atgatgcgcg gtacatttgc taatattaga cttaaaaacc tccttgcacc tggtactgaa      2280
     ggcggtgtta cccgcacgca acctgatgat gagcttgcca gtatttatga tgccgccatg      2340
     gaatatcaaa agaacgatac gccattggtt attttagctg gtaaagaata tggtaccggc      2400
     tcatctcgtg actgggcggc gaaaggctcg ctactgttag gtgttaaagc tgtaatagca      2460
     caaagctatg agcgtattca tcgctctaac cttattggta tgggagtttt accactacag      2520
     tttaaagatg gcgaaagtca tgagtcgcta ggtttaaccg gccaagagca gtttgatatt      2580
     gaaggcttgt ttgataaaac caaggaagtt agcgttattg caactaatag tgaaggtaaa      2640
     aaagtaagct ttagtgccga tgtacgtatt gatacgccaa aagagtggga ttactacaaa      2700
     cacggtggca ttttacagta tgtacttcgt aatatgctcg attaa                      2745
//

If you have problems or comments...

PBIL Back to PBIL home page