(data stored in ACNUC7421 zone)

EMBL: CR954246.ACNB

CR954246.ACNB        Location/Qualifiers
FT   CDS_pept        193464..196106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="PSHAa0184"
FT                   /product="bifunctional protein [Includes: aconitate
FT                   hydratase 2; 2-methylisocitrate dehydratase] (iron-sulfur
FT                   protein)"
FT                   /function="2.1.2 : TCA and related cycles"
FT                   /EC_number="4.2.1.3"
FT                   /EC_number="4.2.1.99"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11992126, 12486059; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85287"
FT                   /db_xref="GOA:Q3IJ30"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ30"
FT                   /protein_id="CAI85287.1"
FT                   /translation="MKRYRILSRHQEGNIVLQEYRKHVEERAALGIVPAPLDAQQTADL
FT                   IELIKTPPAGEEEFILDLFANRVPAGVDDAAYIKAGFLAAVAKGETNSPLLSKEKAAEL
FT                   LGTMLGGYNIAPMIDLLDDDTLAPIVVKGLSNTLLMFDAFYDVEEKAKAGNTFAKQIIE
FT                   SWANAEWFTNKPAVAEKISVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKIERD
FT                   GITPDKPGEVGPITQLEELKTKGLPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPFVPN
FT                   KRVGGVCLGNKIAPIFFNTMEDSGALPIELNVDELNMGEQIDIYPYEGVVKQHGTDKVI
FT                   SKFELKSEVILDEVRAGGRIPLIIGRGLTDKARTSLGLGATDIFKVPTATEVSDKGFTL
FT                   AQKMVGKACNVAGIRPGQYCEPKMTTVGSQDTTGPMTRDELKDLACLGFSADLTMQSFC
FT                   HTSAYPKPIDVNTHHTLPDFIMNRGGVSLRPGDGIIHSWLNRMLLPDTVGTGGDSHTRF
FT                   PLGISFPAGSGAVAFAAATGVMPLDMPESILVRFKGEMQPGITLRDLVHAIPYYGIKQG
FT                   LLTVEKKGKINEFSGRVLEIEGVEHLTVEQAFELSDASAERSAAGCTVKLSKESISEYL
FT                   ESNIVMLKWMISEGYGDVRTIERRINAMQDWLANPELMEADKDAEYAHVVEIDLAEIKE
FT                   PVLCAPNDPDDARLLSDVAGEKIDEVFIGSCMTNIGHFRAAGKLLDGFKGQLPTQLWVA
FT                   PPTKMDKDQLIEEGYYGIFGRVGARIETPGCSLCMGNQARVADKATVVSTSTRNFPNRL
FT                   GNGANVFLASSELAAVAAIIGRLPTAAEYQEYAAKINATASDTYRYLNFHRMPAYTKKA
FT                   DNVIIQQAV"
     atgaagcgct accgaatact ttcacgtcac caagagggca atattgtgct acaagaatat        60
     cgtaaacacg tagaagaacg tgccgcgtta ggtatcgtac cagcgccatt agatgctcag       120
     caaacggctg atcttattga attaatcaaa actccaccgg ctggtgaaga agagtttatt       180
     ctcgacttat ttgctaatcg tgtaccggca ggtgttgatg atgcagctta tatcaaagca       240
     gggtttttag cggcagttgc taaaggtgaa actaattctc cactactttc taaagaaaaa       300
     gcggcagaat tattaggaac tatgctaggc ggttacaata tcgcacctat gatagaccta       360
     cttgatgacg acacacttgc acctatcgta gtaaaaggcc tttcaaacac attattaatg       420
     tttgatgcat tttacgatgt agaagaaaaa gcaaaagcgg gtaacacatt cgctaagcaa       480
     attattgagt cttgggcaaa tgcagaatgg tttactaata aaccagctgt tgctgaaaag       540
     atttcagtta ctgtatttaa agtaactggc gaaacaaata cggatgactt gtcacctgca       600
     ccagatgcat ggtctcgtcc agatattcca ctacatgctt tagctatgct aaaaattgaa       660
     cgtgatggta tcactcctga caaaccaggc gaagtaggcc caatcaccca actagaagaa       720
     ttaaaaacta aaggcttacc actagcttac gttggtgatg ttgttggtac gggttcttca       780
     cgtaaatctg caactaactc agtgctttgg tttatgggcg atgatatccc gtttgtacca       840
     aataagcgtg ttggcggtgt atgtctaggt aataaaattg caccaatctt ctttaacact       900
     atggaagatt ctggcgcttt accaattgag ctaaatgttg atgagcttaa catgggcgag       960
     caaattgaca tctacccata cgaaggtgtt gttaagcagc atggtactga taaagtaatc      1020
     tctaagtttg aacttaaatc tgaagtgatt ttagatgaag ttcgtgctgg tggtcgtatt      1080
     ccactaatca ttggtcgtgg tttaacagac aaagcacgta catcacttgg tttaggtgct      1140
     actgatatat ttaaagtacc aacagcaact gaagtatcag ataaaggctt tacactagcg      1200
     caaaaaatgg ttggtaaagc atgtaacgtt gcaggtattc gcccaggtca atactgtgag      1260
     cctaaaatga caactgttgg ctcgcaagat acaacaggtc ctatgacacg tgatgaactt      1320
     aaagatttag cttgtttagg tttctctgca gacttaacaa tgcagtcttt ctgtcataca      1380
     tcggcatacc caaaacctat tgatgtaaac acgcatcaca cgcttcctga tttcatcatg      1440
     aaccgtggcg gcgtttcact tcgcccaggt gacggtatta ttcactcatg gttaaaccgt      1500
     atgttattac cagataccgt aggtactggt ggtgattcgc atacacgttt cccattaggt      1560
     atttcattcc cagctggttc gggtgcagta gcattcgcag cagcaacagg tgttatgcct      1620
     cttgatatgc ctgagtcaat tttggttcgt tttaaaggcg aaatgcaacc aggtatcaca      1680
     ttacgtgacc ttgtacatgc aatcccttac tacggtatca agcaaggctt attaacagtt      1740
     gagaaaaaag gtaaaatcaa cgagttctct ggtcgcgtac tagaaattga aggcgttgag      1800
     cacctaactg ttgagcaagc gtttgaatta tcagatgcat ctgctgagcg ttcagctgca      1860
     ggttgtacgg ttaagctttc aaaagagtct atttctgaat acctagaatc aaacattgtt      1920
     atgcttaagt ggatgatctc tgaaggttat ggcgatgtac gtacgattga acgtcgtatt      1980
     aatgcaatgc aagactggtt agctaatcct gagcttatgg aagcagataa agatgctgaa      2040
     tacgctcacg tagttgaaat cgacttagct gagattaaag agccagttct ttgtgctcca      2100
     aatgatccag atgacgcgcg tttactttct gatgttgctg gcgagaaaat tgatgaagta      2160
     ttcatcggtt cttgtatgac taacattggt cacttccgcg cggctggtaa gttactagat      2220
     ggctttaaag gtcaactacc tactcagctt tgggttgctc cacctactaa gatggacaaa      2280
     gaccaactaa ttgaagaagg ctactatgga atctttggtc gtgttggcgc gcgtatagaa      2340
     actccaggtt gttcattatg tatgggtaac caagcacgtg ttgctgataa agcaacggta      2400
     gtgtctacct ctacacgtaa cttccctaac cgtttaggta atggtgcaaa tgtattttta      2460
     gcatcatctg aacttgctgc agttgcggca attatcggtc gattgccaac tgctgctgag      2520
     tatcaagaat atgcagcgaa gatcaatgca acagcgtcag atacatatcg ctacttgaac      2580
     ttccatcgca tgcctgctta cactaaaaaa gcagacaacg tgatcattca acaagcagtc      2640
     taa                                                                    2643
//

If you have problems or comments...

PBIL Back to PBIL home page