(data stored in ACNUC7421 zone)

EMBL: CR954246.ADD

CR954246.ADD         Location/Qualifiers
FT   CDS_pept        106040..107041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="PSHAa0102"
FT                   /product="adenosine deaminase"
FT                   /function="2.3.1.4 : Salvage of nucleosides and
FT                   nucleotides"
FT                   /EC_number="3.5.4.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11330670, 11440125; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85211"
FT                   /db_xref="GOA:Q3IF68"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF68"
FT                   /protein_id="CAI85211.1"
FT                   /translation="MINRKLPLLDIHRHLDGNVRAQTILELGRQFNITLPADNVAALIP
FT                   HVQVIDPEPNLMAFLQKLDWGVTVLGDYDACRRIAIENIEDAQAQGLDYVELRFSPYYM
FT                   AQSQGLHPQGVVEAVIDGIKSATKGANVKANLIGILSRTYGVKVCQQELDALLAFKDDL
FT                   VAVDLAGDEIGFPGELFVEHFKQVHDAYLAATIHAGEALGAPSIWQAINELGASRIGHG
FT                   VKAIEDIELMNYLRDKRIGIESCLTSNIQTSTVNDLAQHPLKQFLDHGILACINTDDPA
FT                   VEGIEIEHEYLVAAPQAGLSQADIEKAQANALEIAYLSYSDKKALLTMASTR"
     atgatcaata gaaaactacc tttgctagat attcatcgcc atttagatgg taatgtacga        60
     gcgcaaacca tattagaact tggtcgtcag tttaatataa ctttgcctgc tgataacgtt       120
     gcagcactta tccctcatgt acaagtcatt gatcctgagc caaacctgat ggcattttta       180
     caaaaattag attggggtgt aactgtatta ggtgactacg atgcttgtag acgtatagcg       240
     attgaaaata ttgaagatgc acaagcccaa gggcttgatt atgttgagct gcgctttagc       300
     ccctactaca tggcacaaag ccaaggttta caccctcaag gtgtggttga ggcggtaatt       360
     gatggcatta agtcggcaac caaaggcgct aatgtaaaag ctaatttaat tggtatttta       420
     tcacgcacat atggcgtaaa agtttgccaa caagagcttg atgccttact cgcttttaaa       480
     gacgatttag tggctgtaga tttagccggt gatgaaattg gttttccggg tgagttattt       540
     gtagagcatt ttaagcaagt acacgacgca tacttagcag caacaattca tgccggtgaa       600
     gcactaggtg caccaagtat ttggcaagca attaacgagc taggtgcgag ccgtataggc       660
     catggcgtta aagcaattga agatattgaa ttaatgaact atctgcgcga taagcgtatt       720
     ggtattgagt cgtgcttaac tagtaatata caaaccagta ccgtaaatga tttagctcag       780
     catccgctaa aacagttttt agatcatggt attttggctt gtattaatac cgatgatcca       840
     gcggttgaag gtattgaaat tgaacacgaa tacttagtgg cagcgccaca agctggttta       900
     tcacaagccg atatagaaaa agcgcaagct aatgcgcttg aaatagccta cttaagttac       960
     agcgataaaa aagcactgct aacaatggca agtacgcgct aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page