(data stored in ACNUC7421 zone)

EMBL: CR954246.ALAS

CR954246.ALAS        Location/Qualifiers
FT   CDS_pept        546824..549430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="PSHAa0532"
FT                   /product="alanyl-tRNA synthetase"
FT                   /function="3.3.2 : Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9153306, 12588865; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85621"
FT                   /db_xref="GOA:Q3ILF3"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILF3"
FT                   /protein_id="CAI85621.1"
FT                   /translation="MQHMTTAQIRQQFLDFFASKQHQVVPSSSLIPGNDATLLFNNAGM
FT                   VQFKDVFLGAESRPYTRATSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYF
FT                   KQDAIKFAWQFLTEEVKLPKEKLLVTIYHDDEEAFNYWSNDIGLPADRIIRIATADNFW
FT                   SMGDTGPCGPCSEIFYDHGEHIWGGPPGSPEEDGDRFIEIWNLVFMQYNRQNDGTMLPL
FT                   PKQSVDTGMGLERIAAILQGVHSNYEIDLFKGLIAAAASVTNAQDMDDKSLRVVADHIR
FT                   SCAFLISDGVMPSNEGRGYVLRRIIRRAVRHGNKLGAQGAFFYKLVAALIEQMGQAYPE
FT                   LAKQQEIIEKVLRIEEEQFGKTLERGLAILEESLSDLKGDVIPGDLVFKLYDTYGFPAD
FT                   LTADVARERQMTIDNKGFEECMAVQRKTAQQAGKFGADYNDQLKSDKQTTYKGYTTTSH
FT                   SATVVEVFAGSESVSLLEDGQKGIVILDRTPFYAESGGQVGDTGVISVAGGEFTVTNTT
FT                   KLGNAFAHHGIVQGRIGLNDKVEATIDDARRERIKKNHTATHILHETLRQLLGEHVGQK
FT                   GSLVQAERLRFDFSHFEAVTKEELREIERVVNDEIRCNFALSTELMAIDDAKAKGAMAL
FT                   FGEKYDDEVRVVTIGDYSIELCGGTHVERAGDIGLFKIVSESGIAAGVRRIEAVTGADA
FT                   IAYVSEQEQKLNDVAAVVKADSASVLEKVTALLDKSKQLEKQIAQLNDKLASAAGASLL
FT                   DSVVEINGIKLLIANVKGTESKALRGMVDDLKNKIGSGVIALGVASDDKVSLIAGVTKD
FT                   LTGRVKAGELVNHMASQVGGKGGGRPDMAQAGGSEPENLTAALDSVTAWFTEKTQA"
     atgcagcaca tgactaccgc acaaattaga caacagtttt tagacttttt tgccagcaaa        60
     caacatcaag ttgttccttc aagctcgctt ataccgggta acgatgccac tttgttattt       120
     aacaatgccg gtatggtgca atttaaagat gtatttttag gcgcagaaag ccgcccttat       180
     acgcgtgcga ctagctcgca gcgctgtgta cgtgctggcg gtaaacataa cgatttagaa       240
     aacgttggtt atactgcgcg tcaccataca ttttttgaaa tgttaggtaa ctttagtttt       300
     ggtgattact tcaagcaaga cgcgattaaa tttgcgtggc agtttttaac agaggaagta       360
     aagctaccta aagaaaaact gttagttact atttaccatg acgatgaaga agcgtttaac       420
     tactggtcta acgatatagg cttacctgca gatcgcatta ttagaattgc cactgcagat       480
     aacttttggt caatgggtga taccggtccg tgtggcccgt gttctgaaat attttacgac       540
     catggcgagc atatttgggg cggtcctcct ggatcacctg aggaagatgg cgatcgcttt       600
     atcgaaattt ggaacctagt atttatgcag tacaaccgtc aaaacgacgg aactatgctg       660
     ccactaccta agcaatcggt tgatacaggt atggggcttg agcgtattgc tgctatttta       720
     caaggcgtgc attcaaacta tgaaattgac ttatttaaag gcttaattgc cgctgctgca       780
     agtgttacta acgcacaaga catggacgac aaatcactac gcgtagtggc ggatcatatt       840
     cgttcgtgtg catttttaat ctctgacggg gttatgccat ctaacgaagg ccgtggttat       900
     gtactacgtc gtattattcg ccgtgctgtt cgccatggta ataagttagg tgcacaaggt       960
     gcctttttct ataaattagt agctgcactt attgagcaaa tgggccaagc gtacccagag      1020
     cttgcaaagc agcaagaaat tattgaaaaa gtattacgca ttgaagaaga gcagtttggt      1080
     aaaacgctag agcgtggttt agctatttta gaagaaagct taagcgacct taaaggtgat      1140
     gtaattcctg gcgacttagt atttaaactt tacgatactt atggctttcc tgcggattta      1200
     actgcagatg tggcgcgtga gcgtcaaatg acgattgata ataaaggctt tgaagagtgc      1260
     atggcggtgc agcgtaaaac agcgcagcag gccggtaaat ttggtgccga ttataacgat      1320
     caattaaagt cagacaaaca aacaacttac aaaggctaca ccaccactag ccatagtgcg      1380
     actgtggttg aagtgtttgc tggcagtgag tcggtttcat tactagaaga tggccaaaaa      1440
     ggcattgtaa tactagaccg tacgccattt tatgcagagt cgggcggcca agttggtgat      1500
     acaggtgtaa ttagcgttgc tggtggcgag tttacagtaa ctaacacgac taaattaggt      1560
     aatgcatttg cacaccacgg tatagtacaa ggccgtattg gtcttaacga taaagtagaa      1620
     gcaacaattg atgacgcacg ccgcgaacgc atcaagaaaa accatactgc gacgcatata      1680
     ttgcacgaaa cactgcgcca attattaggc gaacatgtag gtcaaaaagg ctcgctagtt      1740
     caagcagagc gtttgcgttt tgacttttca cattttgaag ctgttaccaa agaagaatta      1800
     cgcgaaattg aacgtgtagt aaacgatgaa attcgttgta actttgcgtt aagtactgag      1860
     cttatggcaa tagatgacgc taaagcaaaa ggtgcaatgg cgttatttgg cgaaaaatac      1920
     gatgacgaag tacgtgtagt tactattggg gactactcta ttgagctttg tggtggaaca      1980
     catgttgaac gcgcaggtga tattggttta ttcaaaatag tatctgaaag cggtattgct      2040
     gcgggtgttc gtcgtattga agcggtaacc ggcgctgacg cgattgccta cgtgagtgag      2100
     caagagcaaa agctaaatga tgtagctgct gtagttaaag ccgacagcgc gtcagtactt      2160
     gaaaaagtaa ctgcgctgct tgataaatca aaacagctag aaaaacaaat tgcgcaactt      2220
     aacgataagc tagcaagtgc tgcgggtgcc tcattacttg attcagtagt agaaattaac      2280
     ggtattaagc tattaatagc caacgttaag ggcactgagt caaaagcgtt acgtggtatg      2340
     gttgatgatc ttaaaaacaa aattggctcg ggtgttattg cactaggtgt tgcaagcgat      2400
     gataaagtga gcttaattgc aggtgtaact aaagatttaa ccggtagagt taaagccggt      2460
     gagctagtta accatatggc cagccaagta ggtggtaaag gtggcggccg tccagatatg      2520
     gcacaagcgg gtggctctga gccagaaaac ctaactgcag cattagacag tgtaacagct      2580
     tggtttactg agaaaacaca agcttaa                                          2607
//

If you have problems or comments...

PBIL Back to PBIL home page