(data stored in ACNUC7421 zone)

EMBL: CR954246.AMIB

CR954246.AMIB        Location/Qualifiers
FT   CDS_pept        280889..282184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiB"
FT                   /locus_tag="PSHAa0268"
FT                   /product="N-acetylmuramoyl-l-alanine amidase II, murein
FT                   hydrolase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /EC_number="3.5.1.28"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8824618; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85367"
FT                   /db_xref="GOA:Q3IDT8"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT8"
FT                   /protein_id="CAI85367.1"
FT                   /translation="MSSSLWAQNTINSVRVWPSPDSTRVVFDLTEKPDFSYFMLKNPSR
FT                   LVVDLEQTRELKVLPGIPPEHQIVSKLRYSKPKNKHSVRFVFELSAPVKPVVFALAPTG
FT                   PYKNRLVVDLYDKSESSTAVSPAQTAAKNRQLSQERDIVIAIDAGHGGEDPGSIGPSGT
FT                   YEKTITLQIAKRLERMIDSERGMISRMVRSGDYFVKLNTRTNRAREKKADFFVSIHADA
FT                   FTSPGPNGASVWVLSLRRANSEIGKWIEDKEKHSELLGGAADVIKDAANEKYLAQALLD
FT                   MSMDHSMKTGLSVADEVVKELRKVAKLHKKDPQHASLAVLKSPDIPSILIETGFISNPR
FT                   EEKLLKSANHQERLAKAIFTSIKNYYLKNPPDDSLFAKLKSQYPTKHKVRPGESLSMLA
FT                   SRYGITINKLKQANKLSSNTLFIGQELDIPQS"
     atgagttcgt cgctatgggc acaaaatacc attaatagtg tgcgcgtttg gccatctccc        60
     gatagcactc gggtggtatt tgatttaact gaaaagcctg attttagtta ttttatgctt       120
     aaaaatccta gccgtttagt ggttgattta gagcaaacac gggagcttaa agtgttaccc       180
     ggtattccgc ctgagcatca aattgttagt aagcttcgtt attctaaacc aaaaaataaa       240
     cacagcgtgc gctttgtatt tgaattgagt gccccggtaa agcctgtggt ttttgcatta       300
     gcaccaacgg gtccctataa aaacaggttg gttgttgatc tatatgataa aagtgaatca       360
     tccacagcag tatcaccagc gcaaacagcg gctaaaaacc gtcaattaag ccaagagcgc       420
     gatattgtta ttgcgattga cgctggtcac ggtggcgaag accctggctc aattggccca       480
     tcgggtacct atgaaaaaac gattacatta caaatagcta aacgcttaga gaggatgatt       540
     gactctgagc gcgggatgat ttcgcgtatg gtgcgcagcg gcgattactt tgtaaagctc       600
     aatacccgca ccaatcgtgc tcgtgagaaa aaagctgatt tttttgtctc tattcatgct       660
     gatgcattta cgagcccagg tccaaatggt gcctcagtgt gggtgttatc actgcgccgt       720
     gctaactcag aaataggtaa atggattgaa gataaagaaa aacactctga gcttttaggt       780
     ggcgcggcag atgtaataaa agatgccgcc aatgaaaagt acttagcgca agcactgctt       840
     gatatgtcga tggatcattc gatgaaaacc ggtttgagcg ttgctgatga agtagtaaaa       900
     gagctgcgta aggtggcaaa gttacataaa aaagaccctc aacatgcgag tcttgcagta       960
     ttaaagtcac cagacattcc ttctatttta atcgaaacag ggtttatttc taatccccgt      1020
     gaagaaaaat tgctaaaaag tgctaatcac caagagcgtt tagccaaagc tatatttacc      1080
     tcaattaaaa attattactt aaaaaatcca cctgacgatt ctttatttgc caagttaaag      1140
     tcgcaatatc caaccaagca taaagttcgc ccgggggagt cgttaagcat gttagcgagt      1200
     cgctacggca taactataaa caagttaaag caggcgaata aactaagctc taatacctta      1260
     tttattggcc aagaactcga tataccgcaa agttaa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page