(data stored in ACNUC7421 zone)

EMBL: CR954246.AMPD

CR954246.AMPD        Location/Qualifiers
FT   CDS_pept        401490..402044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="PSHAa0388"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine amidase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85486"
FT                   /db_xref="GOA:Q3III1"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q3III1"
FT                   /protein_id="CAI85486.1"
FT                   /translation="MNIDLNGVVNCALQRGCSHFDERPSDTDVSLLVIHNISLPAGQFG
FT                   TPYVDDLFMGTLNCEAHSSFSDLHGVRVSAHCFIKRSGELVQYVPFTKRAWHAGASEFN
FT                   GQTNCNNFSIGIELEGTDTTAYTLAQYTSLKILSEAIMQRYPNITTERIVGHCDIAPGR
FT                   KTDPGSSFNWHLFLTMLKQSG"
     atgaacatag atttaaatgg ggtggtaaat tgtgctttgc agcgtggttg ttcgcatttt        60
     gatgagcgcc cgagtgatac agacgtttct ttattggtaa ttcacaatat atccttgccg       120
     gcggggcagt ttggtacacc ctatgttgat gatttattta tgggtacgct taattgtgaa       180
     gcgcatagca gctttagcga tttacacggt gtgcgggtgt cggcacattg ctttattaaa       240
     cgcagcggtg agctagtgca gtacgtgcca tttactaaac gagcatggca tgctggggcg       300
     tctgagttta acgggcaaac taactgcaat aactttagca ttggcattga gcttgaggga       360
     accgacacca ccgcttatac tttagcgcaa tacactagtt taaaaatatt aagtgaagcc       420
     ataatgcaac gctatccaaa tataacaaca gagcgaattg tagggcattg cgatatagca       480
     ccagggcgaa aaacagaccc cggtagtagc tttaactggc atttattttt aactatgctt       540
     aaacaatcag gctaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page