(data stored in ACNUC7421 zone)

EMBL: CR954246.AMPH

CR954246.AMPH        Location/Qualifiers
FT   CDS_pept        346985..348526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="PSHAa0335"
FT                   /product="putative beta-lactamase, penicillin-binding
FT                   protein"
FT                   /function="4.2 : Detoxification"
FT                   /function="1.1 : Cell wall"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 9324260; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85434"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR021860"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF02"
FT                   /protein_id="CAI85434.1"
FT                   /translation="MKLIKFATIALLAGATFSTWAQVDTNKIEQVIKTSMARFDVPGMA
FT                   VAIVENDKVIFAKGFGVTHINTGNKVNKDTLFGIASNTKAFTSAALAKLVDEGKLSWDD
FT                   KVIDHLPEFQLYDAYVTREMRIRDLLSHRSGLGLGQGDLMIWPSTDKSVDDILAGLKYL
FT                   KPASSFRSQYAYNNLMFVTAGEVVARVSGMSWNDYIEKNMLQPLNMTHSRAGFSRIPSS
FT                   NKNWATGHIPMDNQLHPFFVNYLEDFRGAGAIASSASDMSQWLRTQLAGGTMPNGEQLF
FT                   SEKQQAQMWHPHITAMASKSAFEAYHQQFRGYGLGWSIEDYHGFKKLGHNGGILGMVSQ
FT                   VTLLPEKKLGIVILSNQQALGALAAVTHEVLEDALELEDKDWVEDLAKKHFESKEKAYG
FT                   NAKPAAPADYQPQLPNINYTGTLHDNWYGDVIIEQLDGKLHIDFTHTKGLKGSLEHYTG
FT                   NTFIVKWDEKLLEADAFINFNMNTENRVSSAKMRAVSTQVTDFSFDFRNLKLTAK"
     atgaagttaa ttaagtttgc cacaattgct ttattagcag gggctacgtt tagtacctgg        60
     gcacaggtag ataccaataa aatagagcag gtaattaaaa cctccatggc acgttttgat       120
     gtgccaggaa tggcagttgc tattgttgaa aacgacaaag tgatatttgc taaaggtttt       180
     ggtgtaaccc atataaacac cggcaataag gttaataaag acaccttgtt tggcattgca       240
     tctaacacca aagcatttac cagtgcggcg ctggctaagt tggttgatga aggtaagttg       300
     agctgggacg ataaagtgat tgatcacctg ccagaatttc aactatatga cgcatacgta       360
     acccgcgaaa tgcgtattcg cgatctgcta agccatcgca gtgggttggg gcttgggcaa       420
     ggcgacttaa tgatttggcc aagtaccgac aagtcggttg atgatatttt agccgggtta       480
     aaatacttaa aaccggctag cagctttcgc agccaatatg cgtataacaa cttaatgttt       540
     gttaccgcag gggaagtggt agcacgcgta tctgggatga gttggaacga ttacatcgaa       600
     aaaaacatgt tacagccact aaatatgact cactcgcgag cggggttttc gcgcattcca       660
     agtagcaata aaaactgggc aacggggcat attccgatgg ataaccaact ccatccattt       720
     tttgttaact acctagaaga ttttagaggc gctggggcaa tagcctcaag tgccagcgat       780
     atgagccaat ggctacgtac gcaacttgct ggtggcacaa tgccaaatgg cgagcagtta       840
     tttagcgaaa aacaacaagc gcaaatgtgg catccacata taacggctat ggcgtctaaa       900
     agcgcgtttg aggcgtatca tcagcagttt agaggttacg ggctaggctg gagtattgag       960
     gactaccacg gctttaaaaa actcggccac aatggcggta ttttaggcat ggtgtcgcag      1020
     gttacattac tacctgaaaa aaaactcggt attgttattt taagtaacca acaagccttg      1080
     ggtgcgttag cagcagtaac ccacgaagtg cttgaagatg cgcttgagct tgaagataaa      1140
     gattgggttg aagacttagc taaaaagcat tttgaaagca aagagaaagc atacggtaac      1200
     gcaaagcctg cagcgccagc tgattatcaa ccgcaactac ctaatattaa ttacactggt      1260
     acattgcacg ataattggta cggcgatgta attattgagc agcttgatgg caaattacat      1320
     attgatttta cccataccaa gggcttaaaa ggctcacttg agcattacac tggcaatact      1380
     tttattgtta agtgggatga aaagctactt gaggctgatg cgtttattaa ctttaatatg      1440
     aatacagaaa acagagtgag tagcgctaaa atgcgtgcag tatcaacgca agtaaccgac      1500
     tttagttttg actttagaaa tttaaaatta acagcaaaat aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page