(data stored in ACNUC7421 zone)

EMBL: CR954246.ARCA

CR954246.ARCA        Location/Qualifiers
FT   CDS_pept        complement(566343..567059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="PSHAa0551"
FT                   /product="aerobic respiration control protein arcA (Dye
FT                   resistance protein)"
FT                   /function="3.2.1.1 : Regulation"
FT                   /function="1.7.2 : Cell division"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2984198, 7565118; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85639"
FT                   /db_xref="GOA:Q3ILJ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ3"
FT                   /protein_id="CAI85639.1"
FT                   /translation="MQTPVILIVEDEDVTRLNLVSLFEAEGYKVIEAIDGDDMHDKLTN
FT                   NDDVNLVVMDINLPGKNGLILARELRQKRKVGLIFLTGRDNDVDRILGLEIGADDYITK
FT                   PFNPRELTIRARNLITRTALGGEESALETNGVITFNGWELDENSRCLTSPGGDAKRLPK
FT                   GEYRALRLMLDSPGRIFSREQLIKHMTGRELRANDRTVDVTIRRIRKHFESDNSTTELI
FT                   STIHGEGYRFIGKIDS"
     atgcaaacgc cagtcattct gatagtagag gatgaagacg taactagact aaacctcgtt        60
     agtttatttg aagctgaagg ttacaaagtt attgaagcca ttgatggcga tgacatgcat       120
     gataagctta caaataatga cgacgtcaat cttgtagtta tggatatcaa tctaccgggt       180
     aaaaacgggc taattttagc acgtgagtta cgccaaaaac gcaaagtcgg tcttattttc       240
     ttaacaggcc gtgacaatga tgtagatcgt attttaggcc tagaaattgg tgctgatgac       300
     tatattacta aaccgtttaa tcctcgcgaa ttaactattc gtgcgcgtaa tttaattact       360
     cgtactgccc taggtggtga agagtctgca cttgaaacaa atggtgtaat tacgtttaac       420
     ggttgggaac ttgacgaaaa cagtcgctgt cttacttctc caggtggaga cgcaaaacgt       480
     ctacctaaag gcgaatacag agcactgcgt ttaatgcttg actctccagg tcgtattttt       540
     agccgtgagc aattaattaa acacatgact ggccgtgagc tacgtgcaaa cgatagaaca       600
     gttgatgtta caattcgtcg tattcgtaag cactttgaaa gcgacaactc aacaactgag       660
     ttgatcagca ccattcatgg tgaaggttat cgcttcattg gtaaaatcga cagctaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page