(data stored in ACNUC7421 zone)

EMBL: CR954246.ARCB

CR954246.ARCB        Location/Qualifiers
FT   CDS_pept        564020..566338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="PSHAa0550"
FT                   /product="aerobic respiration control sensor protein arcB"
FT                   /function="3.2.1.1 : Regulation"
FT                   /function="3.3.6 : Protein modifications"
FT                   /function="1.7.2 : Cell division"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /EC_number="2.7.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85638"
FT                   /db_xref="GOA:Q3ILJ4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ4"
FT                   /protein_id="CAI85638.1"
FT                   /translation="MTDSSLSPWARVLSSLITRFGEFKTAAICYALLLAVSLVLSSMFY
FT                   YVAVGEVNLVDILAVVFFTSVVSPLVISVLINSIRQLDASYAYLDSATKQEKLLNQTLK
FT                   DNINRLNVEIDERKMAFHAKHRAIEELRKEIAERKKTQQELAQQSMLQRSIVDSSPDLF
FT                   YYRDNNGVFAGCNKMFEEVMGKTSDELIGKSAEQIFPNQFLSEVLKTDKQVEQTHQALT
FT                   IDVQYDVGGETRWFELRKLPFINDKGKYIGLLAFGRDITSRKEAAEALETAYKDKGKFI
FT                   ATLSHELRTPLNGIVGLTRMLLDTELNKQQRSWCNTVFSSAETLGNIFNDIIDLDKIDR
FT                   EQLDIATNAINVSDFINDVVNFAGLIAEQKDLSFDIKRLGMLDIYAQLDPTRLRQVVWN
FT                   LINNAVKFTHKGSVTLTCIRENRDDGPWLTMKISDTGEGIPAEQLSRIFDMYYKAPDLK
FT                   GTNAIGSGIGLAVTKALVDAMQGIISVNSTEGEGSCFIVEIPLILCSAPTENSYVGRSL
FT                   NILLVEDVPLNAEIATNLLEQRGHEVIWAETGEDALSFVETEDDLDLILLDMQLPDING
FT                   DEVARQIRADSHFDKLPIVALTANVRSAEQELEGISIQGALAKPINTVKLDKILADLFG
FT                   IKQTRSNEPQLKVSTAALADINAHLLDVETIEDFVNSMGLVVFKRSSQLFEKLNPQYQQ
FT                   ELLTSLNSGDREEYKSVAHKLKGAAGSVGLNDVQLHAKVMEYGALDKSDEVLKQWLDVL
FT                   ADKINEGQHALHLFLQQLE"
     atgaccgatt cttctttgag cccttgggct cgagttcttt ctagtttaat aactcggttt        60
     ggtgagttta aaactgcagc catttgctat gctttgttat tggcagtttc gcttgtttta       120
     tcaagtatgt tttattatgt tgccgttgga gaagttaatc ttgttgatat attggcagtg       180
     gtatttttta cctctgtggt atcgcctctg gttataagcg tgctaataaa ttcaatcagg       240
     caactagatg cctcctacgc atatttagac agtgcgacaa aacaagaaaa gctactcaat       300
     caaacattaa aagataatat aaatcgctta aatgtagaaa ttgatgagcg taaaatggcg       360
     ttccatgcca agcaccgggc aatagaagag ctaagaaaag aaattgctga gcgtaaaaaa       420
     acacaacaag agcttgccca gcaaagtatg ctacagcgct caatagtaga ctcctccccc       480
     gatttatttt attaccgcga caacaacggt gtgtttgctg gctgtaataa aatgtttgaa       540
     gaagtaatgg gtaaaaccag tgacgaatta atcggtaaga gtgctgaaca aatatttcct       600
     aatcaatttt tatctgaagt tttaaaaacc gataaacagg tagagcaaac tcatcaagca       660
     ttaactatag atgttcaata cgatgtgggc ggcgaaacgc gttggtttga attacgtaaa       720
     ttgccattta ttaacgataa aggtaagtac ataggtttac ttgcatttgg ccgtgatatt       780
     acgagtcgta aagaggctgc agaagcactt gaaacagcct acaaagataa aggtaagttt       840
     attgccactt tgagccatga gttacgtaca ccacttaatg gcattgttgg tttaacacgt       900
     atgttgcttg atacagagct taataaacag cagcgtagtt ggtgtaatac ggtgttttcg       960
     agtgccgaaa cactaggtaa tatatttaac gacattatag atttagacaa aatagacaga      1020
     gagcagttag atattgcaac taatgctata aacgtatctg actttattaa tgatgtggtt      1080
     aactttgcag gcctaattgc tgaacaaaaa gatctttctt ttgatattaa acgcttaggc      1140
     atgctagata tttatgcgca actagatcca acccgacttc gccaagttgt ttggaactta      1200
     ataaataatg cggttaaatt tactcataag ggcagtgtaa ccctcacctg tattcgtgaa      1260
     aatcgagatg atggcccttg gcttaccatg aaaatatcag acaccggaga aggcatacca      1320
     gccgaacagc tctctcgtat ttttgatatg tattataaag cgccagatct taaaggcacc      1380
     aatgctattg gttctggcat tggcttagca gtaaccaaag ccttagttga tgcaatgcag      1440
     gggattattt cggttaatag taccgaaggc gaggggagct gctttatagt agaaataccg      1500
     ctaattttat gtagcgcacc cactgagaat agttatgtag gacgcagctt aaatatactg      1560
     ttagtagaag atgtgccgtt aaatgccgaa attgcgacta acttacttga acagcgtggt      1620
     catgaagtta tttgggctga gaccggcgaa gatgcattgt cttttgtaga aactgaagac      1680
     gatttagatt tgatcttact tgatatgcag ttacccgata taaacggtga tgaagtagca      1740
     aggcaaataa gagccgatag ccattttgat aaactaccta ttgtagcgct taccgcaaat      1800
     gtgcgcagtg cagagcaaga gctagagggg atttcaatcc aaggagcgct cgctaagcct      1860
     atcaatacgg taaaactaga taaaatatta gctgatttat ttggtataaa acaaacaaga      1920
     agtaatgagc cacaattaaa agtaagtaca gcagcgcttg ctgacattaa tgcacattta      1980
     cttgatgttg aaactataga agactttgta aactcaatgg gtttggtggt gtttaaacgc      2040
     agtagtcagt tatttgaaaa actcaatccc caatatcagc aagagttact tacctcgtta      2100
     aactcaggcg acagagaaga atataaatca gttgcacata agcttaaagg tgctgcggga      2160
     tctgtaggct taaatgatgt gcaattgcat gcaaaagtaa tggagtatgg tgcgctggat      2220
     aaatctgacg aggtgttaaa gcagtggtta gatgttttag cagacaaaat aaatgaagga      2280
     cagcatgccc ttcatttatt cttacagcaa ttagagtaa                             2319
//

If you have problems or comments...

PBIL Back to PBIL home page