(data stored in ACNUC7421 zone)

EMBL: CR954246.AROE

CR954246.AROE        Location/Qualifiers
FT   CDS_pept        32922..33746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="PSHAa0031"
FT                   /product="5-dehydroshikimate reductase"
FT                   /function="2.2.1.1 : Aromatic amino acid family"
FT                   /EC_number="1.1.1.25"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85145"
FT                   /db_xref="GOA:Q3IDI6"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDI6"
FT                   /protein_id="CAI85145.1"
FT                   /translation="MDKYAVFGNPIKHSKSPAIHKQFAISLGEQIDYRAILAPIDNFEK
FT                   TVSNFFAQGGKGANVTMPFKEQAFAMADELTPLAKIVGAVNTLKKQADGTLLGDNTDGI
FT                   GFVSDLLANNVSITGKRILIIGAGGAARGVVLPLLDHQPQEVVIVNRTAEKAQNLAKLF
FT                   AQHGNVSGYGFNNLPENDYALIINSTSSSMNDELPALDQKHITNCEVAYDMFYSLQNTI
FT                   FMNWVAQYNSKTKLLDGSGMLVGQAAQAYYVWRNKMPAILPVVNALKQGALT"
     atggacaaat atgcggtttt tggaaatcca ataaaacatt caaaatcccc cgcgatacat        60
     aaacaatttg ctatctcttt aggtgagcaa atcgactatc gcgcaatctt agcacctatc       120
     gataactttg aaaaaacagt atcaaatttt tttgctcaag gcggtaaggg agctaatgta       180
     actatgccct ttaaagagca ggcttttgca atggcagatg agctcacacc attagctaaa       240
     attgtcggtg cagtaaatac cttaaaaaag caagcagacg gcacgttact aggcgataac       300
     accgacggca tcggctttgt aagcgatctg ctggctaata atgtcagtat taccggtaaa       360
     cgtattttaa taataggcgc aggcggggct gcaagggggg ttgttttacc cttgctggat       420
     catcaaccac aggaagttgt tattgttaat cgtaccgccg aaaaagcaca aaatttagca       480
     aagttgtttg ctcaacatgg gaatgtatcg ggttatggtt ttaacaatct accagaaaac       540
     gattatgcgc ttatcataaa ctctacctct agcagtatga atgacgagct tccagcactt       600
     gatcaaaaac atattactaa ctgtgaagta gcgtatgaca tgttttattc actgcaaaat       660
     accattttta tgaattgggt agcgcagtat aatagtaaga ctaaattgtt ggatggcagc       720
     ggcatgctag ttggtcaggc tgcccaggca tattatgtat ggcgtaataa aatgcctgca       780
     atactacctg tcgttaatgc actaaaacag ggagcactta catga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page