(data stored in ACNUC7421 zone)

EMBL: CR954246.AROQ

CR954246.AROQ        Location/Qualifiers
FT   CDS_pept        277864..278316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="PSHAa0264"
FT                   /product="3-dehydroquinate dehydratase (EC 4.2.1.10)
FT                   (3-dehydroquinase) (Type II DHQase)"
FT                   /function="2.2.1.1 : Aromatic amino acid family"
FT                   /EC_number="4.2.1.10"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85363"
FT                   /db_xref="GOA:Q3IDT2"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDT2"
FT                   /protein_id="CAI85363.1"
FT                   /translation="MAAKFKLLVINGPNLNMLGKREPDKYGSRTLSEIMSELTCAADSL
FT                   NVELTHFQSNSEQALIERIHDTWQAIDYIIINPAAFTHTSVALRDALLSVDIPFFEVHL
FT                   SNVHAREAFRHHSYFSDVAQGVICGLGAMGYHAALEAAVNQLQNSN"
     atggctgcaa aattcaagct tttagttata aatggcccaa atttaaatat gctaggtaaa        60
     cgtgagccag ataaatacgg ttcacgtacg ctaagcgaaa ttatgagcga actaacatgt       120
     gccgctgata gtttaaatgt tgagttaacg cacttccaaa gtaatagtga gcaagcactg       180
     atagagcgta ttcacgatac ttggcaagcg attgattaca taattattaa tcctgctgca       240
     tttacgcata cgagcgtcgc attacgtgat gcattgttaa gtgttgatat tccgtttttt       300
     gaagtgcatt taagcaacgt gcacgcacgt gaagcgtttc gccatcattc gtatttttct       360
     gatgtggcgc aaggcgtaat atgtggatta ggtgcaatgg gttatcacgc agcgcttgaa       420
     gctgcagtaa accaattgca aaactcaaat taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page