(data stored in ACNUC7421 zone)

EMBL: CR954246.ASTA

CR954246.ASTA        Location/Qualifiers
FT   CDS_pept        206587..207603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astA"
FT                   /locus_tag="PSHAa0195"
FT                   /product="arginine succinyltransferase"
FT                   /function="2.2.3.2 : Degradation of aminoacids"
FT                   /EC_number="2.3.1.109"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 14675764; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85298"
FT                   /db_xref="GOA:Q3IFT8"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017650"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT8"
FT                   /protein_id="CAI85298.1"
FT                   /translation="MMILRPIQQSDYPALVKIAHESGHGFTSLPNNEKLLQKKIDHSVS
FT                   SFAKAATEPGDEGYLFVLEDTETGEVVGTSGIEAAVGLDDAFYHYHLSKVIHSSRTLNV
FT                   YKAVDILTLCNDYTGATELCTLFLKDAYRKNSNGKLLSKSRFMFIKQHQERFAQTVIAE
FT                   MRGVSDDNGSSPFWQWLEEHFFSMDFPTADYLTGIGQKVFIAELMPKYPIYVNLLSKNA
FT                   QAVIGKVHDNTRPAIELLKSEGFTFNGYVDIFDAGPTVEAKVDNIATIRNAKHFKVEIG
FT                   EPSGDTMVLLANEKLTDFRATVVPMTFDERMSSIVITQQVADALYLQAGDSVSATTI"
     atgatgatcc ttcgcccaat ccaacaaagt gactaccctg cattagtgaa aatagcccac        60
     gaatcgggtc atggctttac ttctttacct aataatgaaa agttattgca aaagaaaata       120
     gatcattcgg ttagctcatt tgcaaaagct gctaccgagc cgggcgacga aggttattta       180
     tttgtactag aggacaccga aaccggtgaa gtagttggca cctcaggtat agaagccgct       240
     gttggcttag atgatgcatt ttatcactat catttaagta aagtgattca ttcttcacgc       300
     actctaaacg tatataaagc agttgatatt ttaacgcttt gtaacgatta caccggcgct       360
     acagagctat gtacattatt tttgaaagac gcataccgca aaaacagtaa cggtaaatta       420
     ctttcaaaat cgcgttttat gtttattaag cagcatcaag agcgctttgc gcaaaccgtc       480
     attgcagaaa tgcgtggtgt gtctgacgac aatggcagca gcccattttg gcaatggcta       540
     gaagagcact ttttttcaat ggactttcca actgccgact atttaacagg cataggccaa       600
     aaagtattta ttgctgaatt aatgcctaag tacccaattt acgttaattt gctcagtaaa       660
     aatgcgcaag ctgttattgg taaagtacac gacaacacac gcccagcaat tgagctatta       720
     aaaagtgaag gttttacctt taatgggtat gttgatattt ttgatgccgg ccccacagtt       780
     gaagcaaaag tagataacat tgccaccatt cgcaatgcta aacactttaa agttgaaata       840
     ggtgaaccaa gtggcgacac catggtgtta ttagccaacg aaaagcttac agattttaga       900
     gcaactgtag tgcctatgac gttcgatgag cgcatgagca gcatagtaat aacgcaacaa       960
     gtagccgatg cactgtattt acaagcgggc gatagcgtaa gcgcaaccac gatttaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page