(data stored in ACNUC7421 zone)

EMBL: CR954246.ASTC

CR954246.ASTC        Location/Qualifiers
FT   CDS_pept        205294..206499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astC"
FT                   /locus_tag="PSHAa0194"
FT                   /product="acetylornithine transaminase (NAcOATase and
FT                   DapATase), PLP-dependent"
FT                   /function="2.2.3.2 : Degradation of aminoacids"
FT                   /EC_number="2.6.1.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85297"
FT                   /db_xref="GOA:Q3IFT9"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT9"
FT                   /protein_id="CAI85297.1"
FT                   /translation="MTVNRELFDHVMVPNYAPSSVIPVRGEGSRVWDQQGREFIDFAGG
FT                   IAVNCLGHCHPALVGALKEQGEKLWHLSNVMTNEPALRLAKKMVDATFAEKVYFANSGA
FT                   EANEAALKLARRFALDQFGAEKSQIIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPGDI
FT                   VHCDYNDLAAFEALISDKTCAVMMEPLQGEGGIVSPTDEFAQGVRDLCTKHNALLIFDE
FT                   VQTGVGRTGNLYAYQGLNVVPDILTTAKALGGGFPIGAMITTTEIAQHLKVGTHGSTYG
FT                   GNPLACAVAEAAFDTVNTPEVLAGVTAKAALFNQLLTEINNKYHVFSEIRGQGLLIGAV
FT                   VSEQYKGRAKEFLVAGTEHGLMSLVAGADVVRFTPSLVIPEADIREGMARFEKAVASVV
FT                   SA"
     atgacagtca atcgcgaatt atttgatcac gtaatggttc ctaactacgc accttcaagc        60
     gtaattccag ttcgaggcga aggctctcgc gtatgggatc aacaaggtcg agagtttatc       120
     gactttgctg gtggtattgc cgttaactgt cttggccatt gccaccctgc attagtaggc       180
     gcattaaaag agcaaggcga aaagctttgg catctatcaa atgtaatgac caacgagcca       240
     gcattacgct tagctaaaaa aatggttgat gcaacctttg ccgaaaaagt ttactttgcc       300
     aactcaggcg cagaagcaaa cgaagcagca cttaaattag cgcgtcgttt tgcccttgat       360
     caatttggcg cagaaaaatc acaaatcatc gcattcaaca aaggtttcca tggccgtaca       420
     ttctttaccg taactgttgg tggccaagcg gcatactcag atggttttgg tcctaagcca       480
     ggcgacattg tacattgtga ttacaacgac ctggcagcat ttgaagccct tattagcgac       540
     aaaacatgtg ccgtaatgat ggagccacta caaggtgaag gcggtattgt ttcgccaact       600
     gacgaatttg cacaaggcgt tcgtgattta tgtactaaac ataatgcact gcttattttt       660
     gatgaagtgc aaacaggtgt tggccgtaca ggtaacttat acgcatacca aggtttaaac       720
     gttgttcctg acattttaac tacggctaaa gcattgggcg gcggttttcc tattggtgct       780
     atgatcacca caactgaaat tgcacaacac cttaaagtag gtacgcatgg ttctacttat       840
     ggtggtaacc cattagcgtg cgccgttgct gaagcagcat tcgatactgt aaatacccca       900
     gaagtacttg ctggtgtaac agcaaaagca gcattattta accaactact tactgaaatt       960
     aataataaat accacgtgtt tagcgaaatt cgcggccaag gtttattaat tggtgcagta      1020
     gtaagcgagc aatacaaagg tcgtgcaaaa gagtttttag tggcaggtac tgagcacggt      1080
     cttatgtcat tagttgccgg tgctgacgtg gttcgcttta caccatcatt agttatccca      1140
     gaagccgaca ttcgtgaagg tatggcacgc tttgaaaaag cagtagccag tgttgtaagc      1200
     gcttaa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page