(data stored in ACNUC7421 zone)

EMBL: CR954246.ASTD

CR954246.ASTD        Location/Qualifiers
FT   CDS_pept        207620..209089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astD"
FT                   /locus_tag="PSHAa0196"
FT                   /product="succinylglutamic semialdehyde dehydrogenase"
FT                   /function="2.2.3.2 : Degradation of aminoacids"
FT                   /EC_number="1.2.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12107143; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85299"
FT                   /db_xref="GOA:Q3IFT7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017649"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFT7"
FT                   /protein_id="CAI85299.1"
FT                   /translation="MTHPAQFINGQWSQGQGTEFSSVNPANNNVIFQANSATAEQVDAA
FT                   VSAAREAFYAWADKTFAERLEIVKAFAAQLKENSEELAITIAQETGKPLWETRTEAGAM
FT                   VGKIAISEKAFLERTGDVENAMPLGRAMIRHKPHGVVAVFGPYNFPGHLPNGHIVPALL
FT                   AGNTVIFKPSELTPKVAELTLKLWEKAGLPAGVINLVQGEVATGKALAAHKGIDGLFFT
FT                   GSSRTGHILHEQFAGQPGKILALEMGGNNPLIITDVEDTKAVVHDIIQSAFISSGQRCT
FT                   CARKLFLPTGSKGDVILERLITATKAIKVGNYDDADQPFMGSMISSAAAAGMVKAQNEL
FT                   VELGAQVLVELEHTVNTGFVTPGIIECTNISDFPDEEHFGPLLKVFRFDDFDQAIDKAN
FT                   DTSFGLSAGLLSDSAADYEHFLRRIRAGIVNWNRPITGASSAAPFGGIGASGNHRASAY
FT                   YAADYCAYPVASVELEKVAMPATLSPGLKID"
     atgactcatc ctgcacaatt tattaatggt caatggtcac aaggccaagg aaccgaattt        60
     agttcagtaa acccagccaa taacaatgtt attttccaag caaactcagc aactgcagag       120
     caagtagacg ctgcagttag cgcagcgcgc gaagcgtttt atgcttgggc tgataaaaca       180
     tttgctgaac gtttagaaat agttaaagca ttcgcagcgc aattaaaaga aaacagcgaa       240
     gagctagcca ttactattgc acaagaaaca ggtaagccac tgtgggaaac tcgcacagaa       300
     gcgggtgcta tggttggtaa aattgccatt tctgaaaaag cgtttttaga gcgcactggc       360
     gacgtagaaa atgcaatgcc actagggcgc gcaatgatcc gccacaagcc acacggtgtt       420
     gtagccgtat ttggtccgta taactttccg gggcatttac ctaatggcca catagtgcca       480
     gcgcttttag caggtaacac ggttatattt aaaccgtcag aacttacgcc taaagtggcc       540
     gagcttacgc ttaagctgtg ggaaaaagca ggtttaccag cgggtgtaat taaccttgta       600
     caaggtgaag tagcaacggg taaagccctt gctgctcaca aaggtattga tggcttgttc       660
     tttacgggtt cttcgcgcac aggtcatatt ttacatgaac agtttgcggg tcaacctggt       720
     aaaattttag cgctagaaat gggcggtaat aacccactta ttattactga cgttgaagat       780
     actaaagcgg ttgttcacga tattattcaa tcagcgttta tttcaagtgg ccagcgttgt       840
     acctgtgcac gtaaactatt tttaccaacg ggtagcaaag gtgatgtaat cctggagcgt       900
     ttaattaccg caactaaagc gattaaagta ggtaattatg acgatgcaga tcagccattt       960
     atgggctcaa tgatctcatc agccgccgct gccggtatgg ttaaagcgca aaacgaactt      1020
     gttgagcttg gtgctcaagt attggtagag cttgagcata cagttaatac tggctttgta      1080
     acaccaggta ttattgagtg tacaaatatt agcgacttcc cagatgaaga gcattttgga      1140
     ccacttctaa aagtattccg ctttgacgac tttgaccaag caattgataa agccaacgac      1200
     acaagctttg gtttatcagc aggtttactt agcgacagtg cagccgacta cgagcacttt      1260
     ttacgccgta ttcgcgctgg tattgttaac tggaaccgcc caattactgg cgcatcaagt      1320
     gctgcaccgt ttggtggtat tggcgcatcg ggtaatcaca gagccagcgc gtattacgct      1380
     gccgattact gtgcataccc agtagcatca gtagagcttg aaaaagttgc tatgccagct      1440
     acattaagcc caggcttaaa aatagactaa                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page