(data stored in ACNUC7421 zone)

EMBL: CR954246.ATOE

CR954246.ATOE        Location/Qualifiers
FT   CDS_pept        complement(147810..149120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoE"
FT                   /locus_tag="PSHAa0136"
FT                   /product="putative short-chain fatty acid transport protein
FT                   (scFAT family)"
FT                   /function="2.4.1 : Fatty acid and phospholipid metabolism"
FT                   /function="1.2.8 : Other"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85240"
FT                   /db_xref="GOA:Q3IF33"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF33"
FT                   /protein_id="CAI85240.1"
FT                   /translation="MLNKIATPFTKLVERYLPDPFIFVILLSVITLVIASVFTPTTGIE
FT                   VLQAWGDGFWNLLSFAMQMLLVLITGYMLASTPPISKLLEKLATFANTAPKAIILVTLI
FT                   SLLASWLNWGFGLVIGALFAKAIAKHTRVDYRLLVASAYSGFVVWHGGLAGSIPLTIAT
FT                   EGHFLQSSMGIISTEQTLFAGFNIAILVGLFIIMPLVNRYMLPSAEESVYIDPALLKST
FT                   SPAIINITRPAQHLEQSKLLGITIGLLGLIYLGYYFLVAGGGLNLNSVIALFLFLAITL
FT                   HQTPHNLLNSLQQAIPSGAGIVIQFPFYAGIMAVMVDSGLAQQISSGFIAIADADSLPF
FT                   FSFISAGLVNMFVPSGGGQWAVQAPIVIPAAQALGADISRVAMAVAWGDAWTNLIQPFW
FT                   ALPVLAIAGLKAKDIMGFCVVQLFVTGVFISLMLSFY"
     atgcttaata aaatagccac tccctttacc aagctcgttg agcgctacct gcctgatccc        60
     tttatatttg taatactgct aagtgttatt accttagtta tcgctagcgt gtttactcca       120
     acaaccggta ttgaggtact gcaagcgtgg ggcgatggtt tttggaactt acttagcttt       180
     gcaatgcaaa tgctgctggt gttaattacc ggctatatgt tggcaagcac tccacctatt       240
     agtaagttac tagaaaagct cgccaccttt gctaacactg caccaaaagc aattatatta       300
     gtaacgctta tttcactact cgctagttgg cttaactggg ggtttggctt agttattggc       360
     gcgttatttg ccaaagctat tgctaaacat acccgagttg attaccgctt attagttgcc       420
     agcgcctact caggttttgt agtgtggcat ggcgggttag caggctcaat tccactgacg       480
     atagccaccg aagggcactt tttgcaatca agcatgggga ttattagcac tgagcaaacg       540
     ctatttgcgg gctttaatat tgccatacta gtagggttat ttattattat gccgctagtt       600
     aaccgttaca tgctaccaag cgccgaggaa agtgtttaca tagaccccgc actattaaaa       660
     agtacctccc ctgcaataat taatattacc aggccagccc aacacttaga gcaaagtaaa       720
     ttgcttggta ttacaattgg attactgggg ttaatttatt taggttatta ctttttagtt       780
     gccggtggcg gcttaaactt aaatagcgta attgcgttgt ttttgttttt agctataacc       840
     ttacatcaaa caccgcataa cttactcaat agcttacagc aggcaattcc tagtggcgca       900
     ggtattgtta ttcaatttcc gttttatgcc ggcattatgg cggtaatggt tgatagtggc       960
     ctagcacagc aaatatcaag cggttttatt gccatagcgg atgcagacag tttgccattt      1020
     tttagtttta taagtgcagg gttagttaat atgtttgtgc cctcgggcgg cggacaatgg      1080
     gcggtacaag cgccaattgt aatacccgca gcgcaagcgc ttggcgccga catatcaagg      1140
     gttgcaatgg cagtagcttg gggcgatgcg tggactaact taattcaacc tttttgggca      1200
     ttacctgtac ttgctatagc aggcctaaaa gccaaagaca ttatgggatt ttgtgtagtg      1260
     cagctatttg taactggggt atttatatcc ttaatgttga gcttttatta a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page