(data stored in ACNUC7421 zone)

EMBL: CR954246.BHBD

CR954246.BHBD        Location/Qualifiers
FT   CDS_pept        417320..418165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bhbD"
FT                   /locus_tag="PSHAa0399"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase
FT                   (Beta-hydroxybutyryl-CoA dehydrogenase) (BHBD)"
FT                   /EC_number="1.1.1.157"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8001771; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85497"
FT                   /db_xref="GOA:Q3IIH0"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH0"
FT                   /protein_id="CAI85497.1"
FT                   /translation="MEVSIIGSGTMATGITQVLCLSNEVSKVNLIARTEEKALASKSTC
FT                   AKNISRLARKGKISDEQASFALEKLYCNAELVAVVNSDLIIEAIVEDFTAKMVLFSKLA
FT                   EFINDSVIVASNTSSLSITAFASVLPNPQNVVGLHFFNPAPIMELVEIIVGHETAPAKI
FT                   QLLQGLTKNLGKVPVVVQEAPGFVVNRMLIPMINEAVSILAEGVATADDIDKAMKFGAH
FT                   HPMGPLALADLIGNDVNLSIMETLYSETGDPKYRAHPLLRKMVRANHLGRKTKKGFFEY
FT                   "
     atggaagtat cgataattgg ttcaggaaca atggcgacag gcataaccca agtgttatgc        60
     ctaagtaatg aagtttcaaa agttaattta atagcaagaa ctgaagaaaa agccctagca       120
     tcaaaaagta cttgtgcaaa aaatatatct cgtcttgctc gcaagggtaa aatttcagat       180
     gagcaagcta gttttgcgtt agaaaagctc tattgtaatg ctgaacttgt tgctgtagtt       240
     aattcagatt taattattga ggcaatagtt gaagatttta cagctaaaat ggtgcttttc       300
     tctaaacttg ctgagtttat aaatgactcc gtaattgtag cttctaatac atcatcttta       360
     tctattactg cttttgctag tgtgttacct aatcctcaaa atgtagttgg attgcatttc       420
     tttaacccgg ctccgataat ggaattagtt gaaattattg taggccatga aactgcacct       480
     gcaaaaattc aactattaca aggtttaaca aaaaacctag ggaaagtgcc tgtagttgtt       540
     caagaggctc ctggttttgt tgtaaatcga atgcttatac caatgattaa tgaagctgtt       600
     agtattttag ctgaaggtgt tgctactgct gacgatattg ataaagcaat gaagtttggc       660
     gcgcaccatc ctatggggcc tttagcgtta gctgatttaa ttggtaatga tgttaattta       720
     tctataatgg aaactcttta cagtgaaact ggagatccta aatacagagc gcatccactt       780
     ctaagaaaaa tggttagagc taaccactta ggtcgcaaaa ctaaaaaagg cttttttgag       840
     tattaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page