(data stored in ACNUC7421 zone)

EMBL: CR954246.COAE

CR954246.COAE        Location/Qualifiers
FT   CDS_pept        complement(395169..395801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="PSHAa0379"
FT                   /product="dephospho-CoA kinase"
FT                   /function="2.5.6 : Pantothenate and coenzyme A"
FT                   /EC_number="2.7.1.24"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11292795; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85477"
FT                   /db_xref="GOA:Q3IID1"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IID1"
FT                   /protein_id="CAI85477.1"
FT                   /translation="MSEQAVKVTNINNWVLGLTGGIGCGKTAVSNMLEALGICVVDADI
FT                   IARQVVEPGSEGLKAIVTHFGADILLADGNLNRSALRELVFSNNEHKNWLNTLLHPLIR
FT                   QQIIIDLNNATSPYVVLVAPLLFENGLDKYCNRTLLIDVPKNVQIERTVKRDNISLEQV
FT                   NSIIAAQMSREQKQQQADDILNNDRSLTLVKHDLIALHKGYLKLALK"
     atgagcgaac aagcggttaa agtaacgaac ataaataatt gggtactagg tttaactggc        60
     ggtataggct gtggtaaaac ggctgtaagc aacatgcttg aagcgctggg tatttgcgtt       120
     gttgatgccg acattattgc gcgccaagta gttgagccag gcagcgaagg gctaaaggca       180
     attgttacac actttggtgc tgatatactc ttagccgacg gcaacttaaa ccgcagtgct       240
     ttacgcgagc tagtttttag caataatgag cataaaaact ggttaaatac cctattacac       300
     ccacttatac gccagcaaat tattatcgat ttaaataacg ccaccagccc ttatgtggta       360
     cttgttgccc cgctactttt tgaaaacggc ctagataaat actgtaaccg cactttactt       420
     atagacgtgc caaaaaacgt gcaaatagag cgcacggtta aacgtgataa cataagctta       480
     gagcaagtaa atagtattat tgccgcgcaa atgtcgcgtg aacaaaaaca acaacaagca       540
     gatgatattt taaataacga tcgcagccta actctagtta agcacgactt aatagctttg       600
     cataaaggct atttaaaatt ggcgttaaaa tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page