(data stored in ACNUC7421 zone)

EMBL: CR954246.CPXR

CR954246.CPXR        Location/Qualifiers
FT   CDS_pept        complement(391491..392180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="PSHAa0375"
FT                   /product="Transcriptional regulatory protein CpxR"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8294007; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85473"
FT                   /db_xref="GOA:Q3IID5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID5"
FT                   /protein_id="CAI85473.1"
FT                   /translation="MKLLMIDDDTGLCELLSEYLTAQGFNVQSVHDGEQGLKLAQANDY
FT                   ALILLDVMLPTLDGFEVLKQLRQTKLTPVIMLTAKGEDFDRIFGLELGADDYIPKPFNH
FT                   RELLARVKAITRRIEHITTMNTTSSNKLVVNGVTINLAAREALIKQTTLTLTGTEYEIL
FT                   ALLAKRAGEVVSKEQISEDVLGRRLASFDRSIDMHVSNIRKKIAEHLPNELIKTIRGTG
FT                   YVFIQGE"
     atgaaactat taatgattga tgacgacaca ggtttgtgtg agctattaag cgagtattta        60
     accgcgcaag gatttaacgt gcaaagcgta cacgacggcg agcagggctt aaaactagcg       120
     caagcgaacg actacgcact aatactactt gatgtaatgc tgcctaccct tgatggtttt       180
     gaagtactta aacaacttag gcaaaccaag cttacgccgg taattatgct taccgccaaa       240
     ggcgaagatt ttgatcgtat ttttggcctt gaacttggcg cagacgatta catacctaaa       300
     ccttttaatc accgtgagtt acttgcccga gttaaagcaa ttacgcgtcg tattgaacat       360
     ataaccacca tgaataccac tagcagcaat aaattagtcg ttaacggggt tactattaat       420
     ttggctgctc gtgaagcctt aattaaacaa acaaccttaa cccttactgg caccgaatac       480
     gaaatactcg cattacttgc caaacgtgct ggcgaggtgg ttagtaaaga gcaaataagt       540
     gaagatgtac ttggcaggcg cttagcctcg tttgatcgct ctattgatat gcacgttagc       600
     aatattcgta aaaaaatagc tgagcactta cctaacgagc taattaaaac cattagaggg       660
     acgggctatg tctttattca aggcgaataa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page