(data stored in ACNUC7421 zone)

EMBL: CR954246.CSD

CR954246.CSD         Location/Qualifiers
FT   CDS_pept        196948..198183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csd"
FT                   /locus_tag="PSHAa0186"
FT                   /product="putative cysteine desulfurase"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.5.14 : Other"
FT                   /EC_number="2.8.1.7"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10939241"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85289"
FT                   /db_xref="GOA:Q3IK63"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK63"
FT                   /protein_id="CAI85289.1"
FT                   /translation="MNITQLREQFPALMQSVNGKSPVFLDGPGGSQVPQSVLNAMTAYL
FT                   GYYNSNLGGAFFSSDKTVELMANARQAAADLLNAPSSQQIVFGPNMTSLTFSFSRAISR
FT                   DWQTGDEIIVTNADHFSNVSSWQQAAEDKGVKVNTALINETDCTLNMAQFESLLNSNTK
FT                   LVAVTYASNTTGSINNIKRIVELAHNVGALVYVDAVHYAPHELVDVQALDCDFLACSAY
FT                   KFFGPHLGMVYGKKEHLEGFTPYKVEPAKDVAPGRWETGTQSFEAMAGFIAAVDYIAAI
FT                   SELDDSHSRREKLSVAFAKTKQHEMALSEYFLTRLVNYPRIKLFGIDDLDRLNERTPTF
FT                   ALTFEGLEPRAVSECLGKQHICVWDGNFYAQGLCEQLGVLDKGGVVRIGCMHYNTTAEL
FT                   DQLFNLFDELLG"
     atgaatataa cgcaattacg tgagcaattt ccggcattaa tgcaaagcgt taatggtaaa        60
     tctcccgtgt ttttagacgg ccccggtggc tcgcaagtac cgcaatcggt acttaacgct       120
     atgactgctt atttgggtta ttacaactca aatttaggtg gagcattttt ctcaagcgat       180
     aaaaccgttg agctaatggc aaatgctcgc caagctgcag ccgatttact caatgcgccc       240
     agctcacaac aaattgtatt tggtccgaat atgaccagct taacgtttag ctttagccgc       300
     gcaatttcac gcgactggca aacgggtgat gaaattattg tcactaacgc ggatcacttt       360
     tctaacgttt cgtcgtggca gcaagccgca gaagataaag gtgttaaagt taatactgcg       420
     cttattaacg aaaccgactg cacactcaat atggcgcagt tcgagagttt actaaacagt       480
     aatactaagc tggtagcggt aacttatgct tcaaatacca caggttcaat taacaatatt       540
     aaacgtattg tagagcttgc ccacaacgta ggcgcacttg tttatgttga tgccgtacat       600
     tatgcaccgc acgaacttgt agatgtacaa gcgcttgatt gcgacttttt agcctgctct       660
     gcgtacaagt tttttggccc gcatttaggt atggtttatg gcaaaaaaga gcaccttgaa       720
     ggatttaccc cgtacaaagt tgagccagct aaagacgtag cgcctggtcg ctgggaaacc       780
     ggcacgcaaa gctttgaagc catggctggt tttatagcgg cggttgatta cattgcagca       840
     attagcgagc ttgacgacag ccattcacgc cgcgaaaagt taagtgttgc ctttgctaaa       900
     accaagcaac acgaaatggc gctgagtgaa tactttttaa cgcgcttagt taattacccg       960
     cgtattaaat tgtttggtat agatgattta gatcgtttaa atgagcgtac gcctactttt      1020
     gcgttaactt ttgaaggttt agagccgcgc gctgtatctg aatgtttagg taagcaacat      1080
     atttgtgtat gggacggcaa cttttacgcg caaggtttgt gtgagcaatt aggcgtactt      1140
     gataaaggtg gcgtagtgcg cattggttgc atgcactaca acaccaccgc agagcttgat      1200
     cagttattta atttgtttga tgagctacta ggttaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page