(data stored in ACNUC7421 zone)

EMBL: CR954246.CUSA

CR954246.CUSA        Location/Qualifiers
FT   CDS_pept        316904..320020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /locus_tag="PSHAa0305"
FT                   /product="cation efflux system protein cusA"
FT                   /function="4.2 : Detoxification"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12813074, 11222619; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85404"
FT                   /db_xref="GOA:Q3ILD1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD1"
FT                   /protein_id="CAI85404.1"
FT                   /translation="MIAAIIRWSVLNRFFVLLLTVILIGGGLFAVKNTPVDALPDLSDV
FT                   QVIIKTSYPGQAPQVVQDQVTFPLTTAMLSVPGAQTVRGFSFFGDSYVYVIFDEKTDLY
FT                   WARSRVQEYLSQVASRLPATASAELGPDATGVGWIYLYALVDKTNQHDISQLRSLQDWF
FT                   LKFELQTVPGVSEVASVGGMVKQYQVTVDPDKLRAYGIPLSLIQTAIAQGNQEMGASVV
FT                   EMAEAEYMVTSTGYIKSVADLEAIPLGVNTNATPLQLRDVADIRLGPQMRRGIAELNGE
FT                   GEVAGGVVVMRFGENAQKTIELVKAKLESLKKGLPAGVEIVPVYDRSNLIKDAVDNLSS
FT                   KLLEELVVVALVCIVFLFHVRSSLVAIITLPLGILTAFLIMYWQGINANIMSLGGIAIA
FT                   IGAMTDGAIVMIENMHKHMEKTPLTDENRWQVVIDSASEVGPALFFSLMIITVSFMPVF
FT                   ILEAQEGRMFAPLAYTKTYAMAASAGLAITLVPVLMGYFIRGKVISEQKNPVNRMLVNA
FT                   YKPLLNAVLKFPKATLALATLIAVIGFYPVNKMGSEFIPPLDEGDLMYMPTTYPGISIG
FT                   KARELLQQTDKLIATVPEVLTVFGKVGRAETATDPAPLTMIETFIQLKPKDQWREGMTL
FT                   DKLKKELDSLVKFPGVTNAWVMPIKTRIDMLATGIKTPVGIKVAGPKLSEIQKIGQQIE
FT                   SILKDVPGTASVYSERVAGGRYIKVDINREKAARYSLNIADIQQVVATAIGGTNVTQTV
FT                   EGQERYPVNLRYPQGYRDSPEELMLLPIVTPAGQRIALADVAKVFIEDGPAGIKSENAR
FT                   LNGWSFIDIENIDIGTYVENAQQILHEQLILPAGYSITWAGQYEYMQRAKDKLAYVLPL
FT                   TLAIIVVLLYLNFRSFAEVLIIIVTLPLAMIGGIWLMYLEGFNFSVAVGVGFIALAGVA
FT                   VEIGVIMLVYLNQAYQEKITQAQQTGVPLNYEQLKQAITEGAGLRVRPVMMTVATIVIG
FT                   LLPVLYGTGTGSEIMSRIAAPMVGGMFSAVVLTLLVIPATYLLWRKRDL"
     atgatagctg caattatacg ttggtccgtt cttaatcgct tttttgtgtt gttactgacc        60
     gttattttaa ttggcggggg cttatttgct gttaaaaata ccccagttga tgccttgccc       120
     gacttatcag atgtgcaagt aattattaaa acctcgtatc cggggcaagc accgcaagta       180
     gtgcaagatc aggttacttt tccacttacc accgcaatgt tatcggtgcc aggagcgcaa       240
     acagtaaggg gcttttcatt ttttggagac tcttacgtat atgtaatatt tgatgaaaaa       300
     accgatttgt actgggcacg tagccgagta caagaatatt taagccaagt agcgagccgc       360
     ttgccagcta cagccagcgc agagcttggc cccgatgcca ccggtgttgg ttggatttac       420
     ttatatgcac tggtagataa aactaatcaa cacgatatta gccaattacg cagcttacaa       480
     gattggtttt taaaatttga actacaaacc gtacctggcg tatctgaggt tgcctcagta       540
     gggggcatgg taaaacagta ccaagttacg gttgaccccg ataagttacg agcttatggc       600
     attccactga gcttaattca aactgccatt gcccaaggca atcaagaaat gggcgcatcg       660
     gtagtcgaaa tggccgaggc tgaatacatg gttactagca ccggctatat taaaagtgtc       720
     gccgatttag aagcgattcc tttaggtgta aatactaatg ccacaccact gcaattgcgt       780
     gatgtggccg atattcgttt agggccgcaa atgcgccgtg gtattgccga acttaatggc       840
     gaaggcgaag tggctggtgg cgtagtggta atgcgcttcg gtgaaaacgc gcaaaaaacc       900
     attgagctgg taaaagcaaa gctcgaatca ttaaaaaaag ggttaccagc gggagttgaa       960
     attgtacccg tgtacgaccg ctccaacttg attaaagatg cagttgataa cttaagcagt      1020
     aaattactcg aagagttggt tgtggttgct ttggtttgca ttgtattttt gtttcatgtg      1080
     cgctcatctt tagtagcgat tattactcta ccactgggta ttttaacagc atttttaatt      1140
     atgtactggc aaggtattaa tgccaatatt atgtcgcttg gcggtattgc cattgcaatt      1200
     ggcgccatga ccgatggcgc catagtgatg attgaaaata tgcacaaaca tatggaaaaa      1260
     accccactaa ccgatgaaaa ccgctggcaa gtggtgatcg attcggccag tgaagtcggc      1320
     cccgcattat tttttagctt aatgataatt acggtaagtt ttatgccggt atttatttta      1380
     gaggcgcaag aagggcgtat gtttgccccg ctggcgtaca ctaaaaccta tgctatggct      1440
     gcctctgctg ggcttgcaat tactttagta ccggtactta tgggatactt tattcgcggc      1500
     aaagtaattt cagagcaaaa aaatccggtt aaccgtatgc tggtaaatgc ttataaacca      1560
     ttacttaacg cagtacttaa gtttcctaaa gcaactttgg ccttagctac gttgattgca      1620
     gtgattggct tttatcctgt aaataaaatg gggagcgagt ttattccccc ccttgatgag      1680
     ggcgatttaa tgtatatgcc aactacttat ccaggtattt cgattggtaa agcgcgggag      1740
     ttgttacagc aaaccgataa attaattgcc actgtgccag aggtactaac tgtatttggt      1800
     aaagtagggc gagcagaaac cgccacagat ccagcgccgc ttaccatgat agaaaccttt      1860
     attcagctca agcctaaaga tcaatggcgc gaaggtatga ccctagataa actcaaaaaa      1920
     gagctagata gtttagtgaa gtttcctggg gtaactaacg catgggttat gccaataaaa      1980
     acccgtattg atatgttagc aaccggcatt aaaaccccgg tggggattaa agttgctggc      2040
     cctaaattga gtgaaattca aaaaataggt caacaaattg aaagcatttt aaaagatgta      2100
     ccgggtacgg catccgttta ttctgagcga gttgctggtg ggcgttatat taaggtagat      2160
     ataaaccgtg aaaaagcggc gcgctatagt ttaaatattg ccgatataca gcaagttgta      2220
     gctactgcta ttggcggcac aaatgtcacc caaaccgtag aagggcaaga gcgctatccg      2280
     gtaaatttac gatacccgca aggttaccgc gattcacctg aggagctaat gttacttcct      2340
     attgtaactc cagccgggca gcgtatagct ttagccgatg ttgctaaggt atttattgaa      2400
     gatggcccag ccggaataaa aagtgaaaat gcccgcttaa atggttggag ctttattgat      2460
     atagaaaata ttgatattgg tacatatgta gaaaacgccc agcaaatttt gcatgagcaa      2520
     ttgatactac cagcaggata ttcaattacc tgggctgggc aatatgaata tatgcagcgt      2580
     gctaaagata agcttgctta cgtattacca ctaacgttag ctattattgt agtgctgctg      2640
     tatctgaact ttagaagctt tgcggaggta ttgattatta tcgttacttt accgttggcg      2700
     atgattggcg gaatatggct aatgtaccta gaaggcttta acttttcggt ggctgttggg      2760
     gtgggcttta ttgcacttgc aggggtggcc gtagaaattg gggtgatcat gctggtgtat      2820
     ttaaatcagg cctaccaaga aaaaattacc caagcacaac aaactggtgt gccgcttaat      2880
     tatgagcagc ttaagcaagc aataacagag ggcgcagggc taagagtacg ccccgtaatg      2940
     atgacagtag ctactatagt gataggttta ttaccggtac tttatggcac tggcacgggc      3000
     agtgaaataa tgagccgcat agcagcgcct atggtagggg gtatgtttag tgcggttgtt      3060
     ttaaccttat tagtaatacc ggcaacgtat ttattgtggc gcaaacgcga cctataa         3117
//

If you have problems or comments...

PBIL Back to PBIL home page