(data stored in ACNUC7421 zone)

EMBL: CR954246.CUTA

CR954246.CUTA        Location/Qualifiers
FT   CDS_pept        275506..275826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="PSHAa0262"
FT                   /product="periplasmic divalent cation tolerance protein
FT                   (C-type cytochrome biogenesis protein)"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7623666"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85361"
FT                   /db_xref="GOA:Q3IDT4"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT4"
FT                   /protein_id="CAI85361.1"
FT                   /translation="MAAQFKLIFTTCKDENEARELAKALVERKLAACVNILPKVASIYI
FT                   WEGEVVEATEAKLLIKTKLDKMNDVFLTIKALHSYEVPEIQVVDVATGNLAYFNWMDEV
FT                   LN"
     atggcggcgc aatttaaact tatttttact acctgcaaag atgaaaatga agcaagagag        60
     ctggcaaaag cattagttga gagaaaactg gctgcatgtg tgaatattct accaaaggta       120
     gcttctattt atatatggga aggtgaagta gttgaggcaa ccgaagctaa actattgatc       180
     aaaacaaagt tagataaaat gaacgatgta tttttaacta ttaaagcatt acacagctac       240
     gaagtgccag agatccaggt tgttgatgtg gcaacgggta acctagctta ttttaattgg       300
     atggatgagg tacttaatta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page