(data stored in ACNUC7421 zone)

EMBL: CR954246.CYAY

CR954246.CYAY        Location/Qualifiers
FT   CDS_pept        97340..97663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="PSHAa0095"
FT                   /product="putative CyaY, involved in iron scavenging and/or
FT                   transfer to heme"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7567469, 8874804, 10908679, 14653404;
FT                   Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85204"
FT                   /db_xref="GOA:Q3IEW0"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEW0"
FT                   /protein_id="CAI85204.1"
FT                   /translation="MTDHEYHQLAEALMFTIEEQVDDCEADLDYESAQGILELIFPDNS
FT                   KIVINKQAPLHQVWVATKFNGHHFELRGDKWIDNRSGAEFWQFINEASTRQAGQDVKWQ
FT                   SSL"
     atgactgatc atgaatatca ccaattagcc gaagcactta tgttcacaat tgaagaacaa        60
     gttgatgatt gtgaagcaga tttagattat gagtcggcac aaggtatttt agaacttatt       120
     tttcctgaca acagtaaaat tgtgattaac aagcaagcac ctttacacca agtatgggtt       180
     gcgactaaat ttaacggaca tcattttgaa ttacgtggtg ataagtggat agataatcgc       240
     tctggcgcag agttttggca gtttattaac gaggcatcaa ctcgccaagc tggccaagac       300
     gttaaatggc aatcatcgtt atga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page