(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSC

CR954246.CYSC        Location/Qualifiers
FT   CDS_pept        complement(216452..217045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="PSHAa0209"
FT                   /product="adenosine 5'-phosphosulfate kinase"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.7.1.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9515915, 10939241, 12072441; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85312"
FT                   /db_xref="GOA:Q3ILQ1"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILQ1"
FT                   /protein_id="CAI85312.1"
FT                   /translation="MDENIVWHNYATTKAQRSEQKKHQSAIIWFTGFSGSGKSTVANAL
FT                   EAALNQQGIHTYLLDGDNVRHGLCKDLGFSDADRVENIRRVGETAKLMVDAGLLVLTAF
FT                   ISPFRAERDMVRSLVDDKEFIEVFIDTPLDVCESRDPKGLYKKARAGEIKHFTGIDSSY
FT                   EIPINPEIILDTSKNTLDQSVVQLITYLKQQHII"
     atggatgaaa atattgtttg gcataactac gcaaccacta aagcacaacg tagtgagcaa        60
     aaaaagcatc agagcgctat tatatggttt accggatttt cgggctcagg taaaagcact       120
     gtagcaaacg cgctagaagc cgcacttaat caacaaggta ttcatactta cctgctcgat       180
     ggcgacaacg tacgccacgg tttatgtaaa gacctaggct ttagcgacgc agaccgagtt       240
     gaaaatattc gccgcgtagg tgaaacggca aaacttatgg ttgacgctgg cttgttagtg       300
     cttactgcgt ttatatcgcc ttttagagca gagcgcgaca tggtacgtag cttagtagat       360
     gacaaggagt ttattgaagt gtttatcgac accccactcg atgtatgcga aagccgcgat       420
     cctaaaggct tatacaaaaa agcccgcgct ggcgaaatta aacactttac cggcattgat       480
     tccagttacg aaatacccat caatccagaa ataattttag ataccagtaa aaacacccta       540
     gaccaatcgg ttgttcagct gataacgtat ctaaaacaac agcacataat atag             594
//

If you have problems or comments...

PBIL Back to PBIL home page