(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSD

CR954246.CYSD        Location/Qualifiers
FT   CDS_pept        complement(220260..221159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="PSHAa0212"
FT                   /product="ATP-sulfurylase, subunit 2 (ATP:sulfate
FT                   adenylyltransferase)"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.7.7.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2828368, 7487067, 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85315"
FT                   /db_xref="GOA:Q3ILR0"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILR0"
FT                   /protein_id="CAI85315.1"
FT                   /translation="MALTHLQQLEAESIKIMREVAAEFENPVMLYSIGKDSSVLLHLAR
FT                   KAFYPAKIPFPLLHVDTNWKFSEMIEFRDRIAKEYGFELLVHKNPEGMEIGISPFEHGS
FT                   GKHTDIMKTQGLKQALDKYGFDAAFGGARRDEEKSRAKERVYSFRDKHHRWDPKNQRPE
FT                   LWNTYNSQVNPGESIRVFPLSNWTELDIWQYIYQENIDMVPLYLAKERPVVDRDGTLIM
FT                   VDDERMPLLEGEVPMMKSVRFRTLGCYPLTGAVESTASSLTEIIEEMLLSTSSEREGRV
FT                   IDHDSAGSMEKKKREGYF"
     atggctttaa ctcaccttca gcagcttgaa gctgaaagta tcaaaatcat gcgcgaagtc        60
     gccgctgagt ttgagaaccc agtaatgctt tactcaattg gtaaagattc gtcggtactt       120
     ttgcacttag cgcgtaaagc attttaccct gcaaaaattc cgtttccgtt attacacgta       180
     gacactaatt ggaagtttag cgaaatgatt gaatttcgtg accgtattgc caaagaatac       240
     ggctttgagc tactagtgca taaaaaccca gaaggcatgg aaattggtat aagcccattc       300
     gagcatggct ctggtaaaca taccgatata atgaaaactc aaggtttaaa gcaagcactc       360
     gacaaatatg gctttgatgc cgcctttggt ggcgcacgcc gcgacgaaga aaagtcacgc       420
     gctaaagaac gtgtttattc atttcgcgat aagcaccacc gctgggatcc taaaaaccaa       480
     cgcccagagc tttggaatac gtacaacagc caagtaaatc caggtgaaag tattcgtgta       540
     ttcccactgt ctaactggac cgagttggat atttggcaat atatttatca agaaaacatc       600
     gacatggtgc ctttgtatct agccaaagag cgccctgtgg ttgatcgcga cggcacctta       660
     attatggttg acgatgagcg tatgccactt ttggagggtg aagtgccaat gatgaagtcg       720
     gtacgttttc gtactttagg ctgctatcca cttaccggtg cagtggaatc aacggccagc       780
     tcattaaccg aaattattga agaaatgctg ctatctacgt catctgaacg tgaaggtcgg       840
     gttattgacc atgactcggc aggctcaatg gaaaagaaaa aacgtgaagg gtatttctaa       900
//

If you have problems or comments...

PBIL Back to PBIL home page