(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSG

CR954246.CYSG        Location/Qualifiers
FT   CDS_pept        complement(221215..222636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysG"
FT                   /locus_tag="PSHAa0213"
FT                   /product="multifunctional siroheme synthase:
FT                   uroporphyrinogen methyltransferase; 1,
FT                   3-dimethyluroporphyriongen III dehydrogenase; siroheme
FT                   ferrochelatase"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.1.1.107"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2550423, 8243665, 7592323, 9150215, 10939241, 11114933;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85316"
FT                   /db_xref="GOA:Q3ILQ9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ9"
FT                   /protein_id="CAI85316.1"
FT                   /translation="MQYLPIFTKLDNKPVLVVGGGDVALRKCSALLKARASITLVAPKF
FT                   CQQLIELASENKVTLIHEYFSEQHLKNMMLVIAATDLEHVNSQVFELANAHNIFVNVVD
FT                   DQPKCTFIFPSIVDRNPITIAISSAGTAPVLARRLREKLETLIPQHIGPLATLVGGFRS
FT                   KVKQRFKHFADRRQFWEGVFDSSVVSKVQTGDTQAAEQQLEHMLNAKAEPEGEVYVVGA
FT                   GPGDPELLTLKALQLMQQADVVVYDYLVSDEIMELVRRDADLICVGKRLGDHSVAQQDT
FT                   NQMLVDLAKQGKKVCRIKGGDPFIYGRGGEEVQVLAANKVNYQIVPGITAAAGCSAYAG
FT                   IPLTHRDHAQAIQFVTGHCKKDGQELDWQSLAKPNQTLAIYMGVIKSPHIQAELLKHGR
FT                   NANTPVAIIENGTRKNQRVITGKLGELADLITRNSVVSPALLIIGEVASLHQELHWFGA
FT                   KAQTSSFAQPLTDVA"
     gtgcagtatt tacctatctt taccaaactc gacaacaaac ctgtattggt tgttggcggt        60
     ggagatgttg ccttgcgcaa atgcagcgcg cttttaaaag cgcgtgccag tattacttta       120
     gtcgctccca aattttgcca acagctcatt gaacttgcta gcgaaaataa agtaacgctt       180
     atacatgagt actttagcga gcaacattta aaaaatatga tgctggtaat tgctgctact       240
     gatttagagc atgtaaatag ccaagtgttt gaactggcta atgctcataa catttttgtt       300
     aatgtagttg acgatcagcc taagtgcacc tttatatttc catcgattgt cgatcgcaac       360
     ccaatcacaa ttgctatatc aagcgcaggc actgccccgg tattagcacg tcgcctacgc       420
     gaaaaattag aaaccctaat accgcaacat attggcccgc tggcaacgct tgtgggtggc       480
     tttagaagca aagtaaaaca acgctttaag cactttgccg atcgtcgcca gttttgggaa       540
     ggcgtattcg actcatctgt tgttagtaaa gtacaaaccg gcgacaccca agccgcagag       600
     caacagttag aacacatgct aaatgctaaa gccgagcccg aaggcgaggt ttatgtagta       660
     ggtgcaggcc ctggcgatcc tgaattgctg acacttaagg cactgcaact tatgcaacaa       720
     gccgatgtag tggtttatga ctatttagtg tctgacgaga tcatggagtt agtgcgccgc       780
     gatgccgacc ttatttgtgt aggcaagcgt ttaggcgatc acagcgtagc gcagcaggac       840
     actaaccaaa tgctggtcga tttagccaag caaggtaaaa aagtatgccg tattaaaggt       900
     ggcgatccgt ttatttatgg tcgtggtggc gaagaagtac aagtacttgc ggctaacaag       960
     gtaaattatc aaattgtacc tggtataact gccgctgcag gatgcagtgc ctatgcgggt      1020
     attccgctta cccatcgtga ccacgcacaa gcgattcagt ttgtaaccgg gcattgtaaa      1080
     aaagacggcc aagaactcga ttggcaatcg ctggctaaac caaatcaaac cttagctatt      1140
     tatatgggcg tgataaagtc gccacatata caagctgagc ttttaaagca tggccgcaac      1200
     gccaatacac ccgttgccat tattgaaaac ggcacccgta aaaatcaacg cgtaattact      1260
     ggaaagctgg gcgagcttgc cgatttaatt acgcgtaaca gtgtggtttc tcctgcgctg      1320
     cttattattg gcgaagtagc atccttgcac caagagttac attggtttgg tgccaaagcg      1380
     caaactagca gttttgcgca accccttacc gatgtggcat aa                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page