(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSH

CR954246.CYSH        Location/Qualifiers
FT   CDS_pept        165235..165975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="PSHAa0156"
FT                   /product="3'-phosphoadenosine 5'-phosphosulfate (PAPS)
FT                   reductase"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.2.1.5 : Serine family"
FT                   /EC_number="1.8.4.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85260"
FT                   /db_xref="GOA:Q3IFM0"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFM0"
FT                   /protein_id="CAI85260.1"
FT                   /translation="MSEFKNILQLDKQSQTSMLADANGILKNMSAEQRVQWALENLPET
FT                   HFLSSSFGIQAAVMLHLITLQQPDIPVVLTDTGYLFPQTYQFIEQMTARLSLNLKVYKS
FT                   ELSPAWQEAKFGKLWEQGEAGIKQYNQLNKVEPMTRALKEINAGTWFSGLRRDQASSRA
FT                   DKQVIEISRGTVKVYPIIEWTNRDVYQYLTKHNLPYHPLWEEGYVSMGDIHTTRKLEPG
FT                   MTEEETRFFGLNRECGLHIDGDGI"
     atgagtgaat ttaaaaacat tttacagtta gataaacaaa gccaaactag catgctagca        60
     gacgccaatg gcatactgaa aaacatgagc gccgagcagc gcgtgcaatg ggcacttgaa       120
     aacttacctg agacacattt tttatcatcg agttttggta ttcaagcggc cgtaatgttg       180
     cacttaataa cattacaaca gccagatatt ccggtggtat taacagatac aggttatttg       240
     tttccacaaa cgtatcaatt tattgagcaa atgacggcac gtttatcact caatttaaaa       300
     gtgtacaaat cagagcttag ccctgcttgg caagaagcta aatttggcaa gttatgggag       360
     caaggagagg ccggaattaa gcagtacaat cagcttaata aagttgagcc gatgactcgc       420
     gccttaaaag aaattaatgc tggtacgtgg tttagtggcc tgcgtcgcga ccaagcatca       480
     agccgtgctg ataagcaagt aattgaaatt agccgtggta cagtaaaagt ttacccaatt       540
     attgagtgga caaaccgcga tgtatatcag tatttaacta agcataactt gccgtaccat       600
     cctctttggg aagaaggcta tgtctctatg ggagacatac atactacacg taagctagag       660
     cccggtatga ccgaagagga aactcgcttt tttggtttaa accgagagtg tggtttgcac       720
     attgatggtg atggtattta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page