(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSI

CR954246.CYSI        Location/Qualifiers
FT   CDS_pept        163494..165191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="PSHAa0155"
FT                   /product="sulfite reductase, beta subunit, NADPH-dependent
FT                   hemoprotein"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.2.1.5 : Serine family"
FT                   /EC_number="1.8.7.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85259"
FT                   /db_xref="GOA:Q3IFM1"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFM1"
FT                   /protein_id="CAI85259.1"
FT                   /translation="MSEQDKNVKLSDNERMKRESNFLRGTIATDLKDEITGGFTADNFQ
FT                   LIRFHGMYQQDDRDIRGERAKQKLEPLHNVMLRARMPGGIIKPEQWLAIDKFAEEKTSY
FT                   GSIRLTTRQTFQFHGVLKPNIKGMHQLLDSVGIDSIATAGDVNRNVLCTTNPVESELHQ
FT                   EAYEWAAKISEHLLPKTKAYAEIWLNGEKAETTEEPILGSNYLPRKFKTTVTIPPNNEV
FT                   DVHANDLNFVAIAENGKLIGFNVLVGGGLAMTHGDTATYPRKADDFGFIPLEHTLKIAE
FT                   HVVSVQRDWGNRSNRKNAKTKYTLDRVGVDVFKAEVEKRAGVEFASSRPYKFTHRGDRI
FT                   GWVEGIDGKHHLTLFIQSGRILDYPDKPLKTGCRKIAEVHQGDMRMTANQNLIIAGVAA
FT                   NQKAVIEEIARNHGLIDDKDTEQRKNSMACVALPTCPLAMAEAERYLPSLVEKIEALLA
FT                   KHGVPNDSIIMRVVGCPNGCGRAMLAEAGLVGKGPGKYNVYLGGNLEGTRIPKLYLENV
FT                   GEDVYLAAFDELIGQWVNERNDGECFGDFVIRKGIVAEVKVSVTDFHA"
     atgagcgaac aagataaaaa cgtaaagctt tctgataacg agcgcatgaa acgagaaagt        60
     aattttttac gtggcactat agcaacagat ttaaaagatg agatcaccgg tggttttacc       120
     gctgataact tccagttaat tcggtttcac ggtatgtacc agcaagatga ccgcgatatt       180
     cgtggtgagc gcgctaagca aaagcttgaa ccattacaca acgtaatgtt acgtgcgcgt       240
     atgcctggcg gtattattaa gcctgagcaa tggttagcca tagataaatt tgcagaagaa       300
     aaaaccagct atggcagtat ccgtttaact acgcgtcaaa cgtttcagtt tcatggtgta       360
     ttaaagccta atattaaagg catgcatcaa ttactggata gcgttggaat tgactctatt       420
     gctaccgcag gcgatgttaa tcgaaatgtg ttgtgtacta ctaatccggt tgagtcagag       480
     ctgcatcaag aagcgtatga gtgggctgca aaaatttcag agcacttatt accaaaaacc       540
     aaggcttacg ccgaaatttg gcttaatggt gaaaaagcag aaaccacaga agagccaatt       600
     ttaggttcta attacttacc gcgtaagttt aaaacaacgg taacaattcc gccgaataat       660
     gaagtggatg tgcacgccaa tgatttaaac tttgtagcta ttgccgaaaa tggtaaatta       720
     attggcttta acgtacttgt cggtggtggc cttgccatga cacatggcga tacagcaacc       780
     tacccacgta aagcagacga ctttggtttt attccactag aacatacgtt aaaaattgcc       840
     gagcatgtgg tgtcggtaca gcgcgattgg ggtaatcgtt caaatcgcaa aaatgctaaa       900
     acaaaataca cattagatcg agtaggcgtt gatgtattta aagcggaagt agagaaacgt       960
     gcgggtgttg agtttgcttc aagtcgtcct tataaattta ctcaccgagg cgatcgtata      1020
     ggttgggttg aaggtataga tggcaaacat cacttaacat tatttattca aagtgggcgt      1080
     attttagatt atccagacaa accactaaaa acaggctgtc gtaaaatagc agaagttcac      1140
     caaggtgaca tgcgcatgac ggcaaaccaa aacttaatta ttgctggtgt agctgcaaat      1200
     caaaaagccg tgattgaaga aattgcccgt aaccatggtt taattgacga taaagacacc      1260
     gaacaacgta aaaattctat ggcgtgtgtg gcactgccaa catgcccatt agctatggct      1320
     gaagctgagc gttatttacc tagtttggtt gaaaaaatag aagcactgtt agccaagcat      1380
     ggtgtgccga atgacagtat tattatgcgc gttgtgggtt gccccaatgg ctgtgggcgt      1440
     gccatgttag ccgaagcggg attggttggg aaaggtccgg gtaaatataa tgtgtatcta      1500
     ggcggtaacc ttgaaggcac acgtattcct aaattatatt tagaaaatgt gggtgaagac      1560
     gtgtatttag ctgcttttga tgaattaatt ggtcaatggg ttaatgagcg taatgacggt      1620
     gaatgctttg gtgattttgt gatccgcaaa ggcattgttg ctgaagttaa agtatcagtt      1680
     accgattttc acgcataa                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page