(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSJ

CR954246.CYSJ        Location/Qualifiers
FT   CDS_pept        161631..163445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /locus_tag="PSHAa0154"
FT                   /product="sulfite reductase, alpha subunit (flavoprotein)"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.2.1.5 : Serine family"
FT                   /EC_number="1.6.2.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85258"
FT                   /db_xref="GOA:Q3IFM2"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFM2"
FT                   /protein_id="CAI85258.1"
FT                   /translation="MLLGQLNAAASPLSQEQVQKLQGLVAELNPIQQAWVSGYLAANAN
FT                   TAALGGAVGAAPSAGEAVALTILYGSQTGNAKGVAAKLKAQAESRGLAVKLVSMADYKP
FT                   TALKKEKFITVVVATYGEGEPPEDAEALHEFLTTKKAPKLDGVKVAVIGLGDSSYEFFC
FT                   QTAKDFEQRLNTLGAETIYQRADLDVDYEDEATTWITGALDAFEPDLKAQQGSSGGQVI
FT                   AMPFAGSTTVASQYTKQNPFAAELGLVQKITGRDSTKDVRHVEISLEGSDISYIPGDSL
FT                   GVYFLNDEARVDELLTHTQIDAASLVKVADEQLSIRDALIEKLELTQSYPGFVEKYAIA
FT                   TGTPQLLKLVEDKAAMHQYIEPRQIFDVVAQNPAKLDAQTLVDCLRKLQARLYSIASSQ
FT                   SEVEDEVHLTVALVEFDAFGREHLGGCSGYLARRAEEGCKVKVFSEHNDNFRLPTNDET
FT                   PIIMVGPGTGIAPFRAFLQERDARGASGKNWLFFGNPHFTQDFLYQVEIQGYLKSGLLS
FT                   KVDVAFSRDQAEKVYVQDKLRSNSKAIFEWLEAGAHFYVCGDANNMAKDVHQTLLEIIK
FT                   ENTGKSDEDAQQYLKDLRSANRYQKDVY"
     atgttgctag gtcaactaaa cgctgcggca agtccgctat cgcaagagca agtacaaaag        60
     ctgcaaggtt tagtggctga gcttaatcca attcaacaag catgggttag tggttatctt       120
     gctgcaaatg ctaatacggc ggctttaggc ggtgctgtgg gagcagctcc aagtgctggt       180
     gaggcagttg cattaactat tttatatggc tcgcaaacag gtaatgcaaa aggtgtagct       240
     gctaagttaa aagcacaagc agagtcacgc ggtttagccg taaagctagt gagcatggcc       300
     gattacaaac caactgcact aaaaaaagaa aagtttataa ctgtggttgt tgcaacttac       360
     ggcgaaggtg aaccaccaga agatgcagag gctttacacg aatttttaac cactaaaaaa       420
     gcgcctaagt tagatggggt gaaggtagcc gtgattggct tgggggattc gagctatgaa       480
     tttttttgcc aaacagcaaa agactttgag cagcggttaa atacactcgg cgcagaaaca       540
     atttatcaac gcgccgattt agatgtagat tacgaagacg aagcgacaac ttggatcact       600
     ggcgcattgg atgcctttga accggattta aaagcacagc aaggtagttc aggtggtcaa       660
     gttattgcaa tgccgtttgc tgggtcaact actgtggcaa gtcaatatac taaacaaaac       720
     ccgtttgccg cagaactagg tttagtgcaa aaaattacag gtcgcgattc aactaaagat       780
     gtccgccacg tagaaatttc gcttgaaggc tcagacatta gttatatacc aggtgattca       840
     ttaggtgtgt attttttaaa tgacgaagcc cgtgttgatg agttgcttac acacacgcaa       900
     attgatgcag ctagtttagt aaaagttgca gatgaacagc taagtattcg cgatgcactg       960
     attgaaaaac ttgaattaac gcagtcgtac cctggctttg tggaaaaata tgcaatagcg      1020
     acaggcacac cacaactatt aaaattggtt gaagataaag cggcaatgca tcaatacatt      1080
     gagccgcgcc aaatatttga tgtagttgca caaaaccccg ctaagctcga cgcgcaaaca      1140
     ctcgtcgatt gcctgcgtaa attacaagca cgtttatatt caattgcctc tagccaaagc      1200
     gaggttgaag acgaggtaca tttaaccgta gcattagttg agtttgatgc ctttggtcgt      1260
     gagcatttag gcggttgttc gggctattta gcgcgccgtg ctgaggaagg ctgtaaagtt      1320
     aaggtattta gtgagcataa cgataatttt cgtttaccaa cgaatgatga aacaccaatc      1380
     attatggttg gccctggtac gggaatagca ccgtttcgag cctttttaca agagcgtgat      1440
     gcgcgtggcg catcaggtaa aaactggctg ttttttggca atccacattt tactcaagac      1500
     tttttatacc aagttgaaat tcaaggttac ttaaagtcgg gtttactaag caaagtagat      1560
     gttgcattta gccgcgatca agccgaaaaa gtgtatgtgc aagacaagtt gcgtagtaac      1620
     agcaaagcta tttttgagtg gcttgaagct ggcgcacatt tttatgtgtg tggcgacgct      1680
     aacaatatgg caaaagatgt gcaccaaaca ttactcgaaa ttattaaaga aaataccggc      1740
     aagagcgatg aagatgctca gcagtattta aaagatttac gcagcgcaaa ccgctatcag      1800
     aaagacgttt actaa                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page